SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000380413 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000380413
Domain Number 1 Region: 598-709
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.31e-39
Family Pyk2-associated protein beta ARF-GAP domain 0.00044
Further Details:      
 
Domain Number 2 Region: 65-234
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.4e-33
Family G proteins 0.00000195
Further Details:      
 
Domain Number 3 Region: 333-407,537-582
Classification Level Classification E-value
Superfamily PH domain-like 1.42e-16
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Domain Number 4 Region: 721-811
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000000575
Family Ankyrin repeat 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000380413
Sequence length 843
Comment AGAP3 (Homo_sapiens) ArfGAP with GTPase domain, ankyrin repeat and PH domain 3
Sequence
QFALSNSAAIRAEIQRFESVHPNIYAIYDLIERIEDLALQNQIREHVISIEDSFVNSQEW
TLSRSVPELKVGIVGNLSSGKSALVHRYLTGTYVQEESPEGGRFKKEIVVDGQSYLLLIR
DEGGPPELQFAAWVDAVVFVFSLEDEISFQTVYNYFLRLCSFRNASEVPMVLVGTQDAIS
AANPRVIDDGRARKLSTDLKRCTYYETCATYGLNVERVFQDVAQKVVALRKKQQLAIGPC
KSLPNSPSHSAVSAASIPAVHINQATNGGSSAFPDSSSSVPSTPSISQRELRIETIAASS
TPTPIRKQSKRRSNIFTSRKGADLDRDKKAAECKVDSIGSGRAIPIKQGILLKRSGKSLN
KEWKKKYVTLCDNGLLTYHPSLHDYMQNIHGKEIDLLRTTVKVPGKRLPRATPATAPGTS
PRANGLPLERSNTQLGGGPGAPHSASSASLHSERTLSSSAWAGPRPEGLHQRSCSVSSAD
QWSMQHPAGGTADVLSSSPKLEPPPSPHSNRKKHRWKKSAGNPRPDGPSSAAEEAEESFE
FVVVSLTGQTWHFEASTAEERELWVQSVQAQILASLQGCRSAKDKARLGNQNAALAVQAV
RTVRGNSFCIDCDAPNPDWASLNLGALMCIECSGIHRHLGAHLSRVRSLDLDDWPPELLG
VMTAMGNALANSVWEGAVDGYAKPGPEACREEKERWIRAKYEQKLFLAPLPSSDVPLGQQ
LLRAVVEDDLRLLVMLLAHGSKEEVNETYGDGDGRTALHLSSAMANVVFTQLLIWYGVDV
RSRDARGLTPLAYARRAGSQECADILIQHGCPGEGCGLAPTPSREPANGPSTSAELHRSP
SLL
Download sequence
Identical sequences G5AMT4
HGL_H00000380413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]