SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000380450 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000380450
Domain Number 1 Region: 27-116
Classification Level Classification E-value
Superfamily PX domain 0.0000000000000154
Family PX domain 0.0018
Further Details:      
 
Domain Number 2 Region: 207-262
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000122
Family SH3-domain 0.0022
Further Details:      
 
Domain Number 3 Region: 121-193
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000289
Family SH3-domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000380450
Sequence length 321
Comment NOXO1 (Homo_sapiens) NADPH oxidase organizer 1
Sequence
MEAAVMASSRHLVSVRAAALVQMERPQKTLKETFPVEAGLLRRSDRLLPKLPDAPLLSRG
GRVGRGLARLRLLETYAQALLATVERVSRSPVLTGFFAPQARDLESALPPGSTVILPAPE
EPSPRPLDSLTIHSLEAQSLCCVQPFHTQDTKGRPFHAEARESLDVLLRHPSGWWLVENE
DQQKAWFPAPYLEEVAHEVGLTQGSSGTQFCISRAYKGSRADELSVPAGARVQVLETSDR
GWWLCRYCDRAGLLPSVLLQPERLGAFLSGPAILGREDRENKATTSSPPVPTRPLLSAIQ
SRCCTITRRALVWNSGPHNPP
Download sequence
Identical sequences G5BY54
HGL_H00000380450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]