SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000380460-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000380460-1
Domain Number 1 Region: 123-297
Classification Level Classification E-value
Superfamily WD40 repeat-like 8.7e-37
Family WD40-repeat 0.00017
Further Details:      
 
Weak hits

Sequence:  HGL_H00000380460-1
Domain Number - Region: 370-587
Classification Level Classification E-value
Superfamily ARM repeat 0.000276
Family Armadillo repeat 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000380460-1
Sequence length 588
Comment PLAA (Homo_sapiens) phospholipase A2-activating protein
Sequence
MAGARTLASHRAQKLPCKQTASWRANADVEFRCACQGCCVTQLAQHFPSSPPFRSASQVL
PVSDCSSPEGPSCAAAWLIPGLPWGQISPGVGVPGAQPILSVASTGARYQLSCSLPGSSG
KFGTLLSGSWYTTAKVWLNGKCMMTLQGHTAAVWAVKIFPEKGLMLTGSADKTIKLWKAG
RCERTFSEHEDCVGGLAILSETEFLFCANDASIRKWQITGECLEVYYGHTNYIYSIAVFP
NCRHFVTTGEDRSLRIWKHGECIQTIRLPAQSIWCCYVLDNGDNVVGASDGIIRVFTESV
DHTASAEEIKAFEKELSQATIDTKTGDLGDINVEQLSGKEHLNEPGKLKELNGTAPEEKK
LTEDDLVLLEKILSLICDSSSEKPTAQQLQVLWKAINWPEDIVFSALHILHLSMKHPSVK
ENFCNEKEGAPFSSHLISLPNPKGKPANQLLALRTFCSCFVGQAGQKLMMSQRESLISHA
IELKSGNNKNIHIALATLTLNYSIYFHKDHNIEGKSQCLSVISTILEVVQDLEGTFRLLV
ALGTLISDDSNAVQLAKSLGVYSKIKKYASVSEPAKVSECCRFIINLL
Download sequence
Identical sequences G5BLX7
HGL_H00000380460-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]