SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000380690 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_H00000380690
Domain Number - Region: 5-186
Classification Level Classification E-value
Superfamily Tropomyosin 0.00248
Family Tropomyosin 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000380690
Sequence length 495
Comment CCDC64 (Homo_sapiens) coiled-coil domain containing 64
Sequence
MSRQYEQMHKELTDKLEHLEQEKHELRRRFENREGEWEGRVSELESDVKQLQDELERQQV
HLREADREKTRAVQELSEQNQRLLDQLSRASEVERQLSMQVHALREDFREKNSSTSQHII
RLESLQAEIKMLSDRKRELEHRLSATLEENDLLQGTVEELQDRVLILERQGHDKDLQLHQ
SQLELQEVRLSYRQLQVKVEELTEERSLQNSAATSTSLLSEIEQSMEAEELEQEREQLRL
QLWEAYCQVRYLCSHLRGNDSADSAVSTDSSMDESSETSSAKDVPAGSLRTALNELKRLI
QSIVDGMEPTSSRRIEDDSLEEQIRQTSEDSRALRELMEGERGKLRQSLEELQQLHSQVT
LLSVEMTALKEERDRFTVTSEDKEPKEQLQKAIRDRDEAIAKKNAVELELTKCKMDMMSL
NSQLLDAIQQKLNLSQQLEAWQDDMHRVIDRQLMDTHLKEQSLPAAAFSRAHSVGRGAEP
STTESKRLFSFFRKI
Download sequence
Identical sequences G5B785
HGL_H00000380690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]