SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000380840-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000380840-1
Domain Number 1 Region: 490-547
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.56e-23
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 546-603
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.57e-23
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 345-401
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.62e-22
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 4 Region: 234-288
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.05e-20
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 5 Region: 2-51
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.92e-20
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 6 Region: 452-504
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.02e-19
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 7 Region: 400-449
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.41e-17
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 8 Region: 307-358
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.96e-17
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 9 Region: 176-230
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.71e-17
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 10 Region: 137-189
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000587
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Weak hits

Sequence:  HGL_H00000380840-1
Domain Number - Region: 99-126
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00313
Family Classic zinc finger, C2H2 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000380840-1
Sequence length 616
Comment ZNF709 (Homo_sapiens) zinc finger protein 709
Sequence
DLVTFEDVAVSFTQEEWALLDPFQKNLYRDVMRETLSNLAFVGRPCQKIKTILKALIIFL
FSYRRHVVERLWEGVKGAQRRETCSQIPDLRLRKKTPAVKSYDYSVCGEVCIGHSSLNRH
TRAHTEHKTCEHKDGKKTYQDKQCGNAFSFHDSFKKSERTCSEEKSYQCKECGKFYTSVS
NFQRHVERHSEDGPYKCKACGKAFYSSNSFLVHERIHTRKKPYQCKQCGKSLSTSKAFQI
HKRTHTGEKPHECEECGKAFNCPSTFQRHKRTHSGEKPYECKKCGKAFGRFSSFRIHERM
HTRTNAYYECEVCGKAFISLSPFQRHMITHTGEGPHKCKECGKIFISSSAFQIHERLHTG
EKPFECKQCGKTLSSASSFQIHERTHTGEKPYECKECGKTFSCPSSFQRHEKTHSGEKPY
ECKQCDKAFSRSCYLQMHERSHTGEKPYTGEKPYQCKQCGKAFRGSSSFQVHKRTHTGEK
PYECKECGKVFSCPSSFKRHQKIHTGEKPYECTQCGKAFGRYSSLQIHERNHTGEKPYEC
QECGKVFRSSSSFQIHKRTHTGEKPYVCQECGRAFSCPSTLQKHERTHTGEKPYPCTKCG
KAFSRSSNFRTHQRSH
Download sequence
Identical sequences G5AJT1
HGL_H00000380840-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]