SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000380840-10 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000380840-10
Domain Number 1 Region: 283-340
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.59e-23
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 2 Region: 507-564
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.96e-23
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 3 Region: 339-396
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.16e-21
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 4 Region: 452-508
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.63e-21
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 5 Region: 395-452
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.36e-20
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 6 Region: 2-53
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.15e-19
Family KRAB domain (Kruppel-associated box) 0.00066
Further Details:      
 
Domain Number 7 Region: 227-284
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.54e-17
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 8 Region: 563-614
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000138
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 9 Region: 188-241
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000026
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000380840-10
Sequence length 614
Comment ZNF709 (Homo_sapiens) zinc finger protein 709
Sequence
EAVSFEDVAVNFTVEEWALLDPFQKKLYRDVMCETFRNVAALGRTWDNEEIEDEYKNCRR
SLSSGEVQKCCEYELWYQHGKMVFWTTDTNMNLIPVGTKPGESPGSTKPPIDHSSANVPI
IANPGFKSCKYWEFEEKLSSCNKHVRSCTDFQSSQKHVNANPGEKPYEYKQHGKLYSDCT
EGANTEEKPFVYDQNVKALSTPNYVPICERNHSGMNNTYICTECGKAFTSHHFMQIHERA
HIGKNPSVCKHCGKSFTNTTSFDNHQRTHNGERPYVCKQCGKAFRTHSDCQRHERTHTGE
KPYVCKQCGKAFSTRSNCQIHERIHTGEKPYVCKQCGKAFSRHSNCQIHERTHIGEKPFE
CKQCGKAFRTHSDCQRHESTHTGEKPYECKQCGKAFRTHSDCQRHESTHSGEKPYVCKQC
GKAFSRHGNCQIHERTHTGERPYICKQCGKGFSRHSACQIHERTHTGEKPYVCKQCGKSF
SRQNHCQIHERTHIGEKPYECKHCGKAFSTHSHCRIHERTHTGEKPYVCKQCGKAFSTHS
NRQVHERTHTGEKPYVCKECGKAFTTQSSCRKHERTHSRVKPYVCNQCGKGFTTQRYCRI
HERTHTGQEPYVCK
Download sequence
Identical sequences G5BEQ4
HGL_H00000380840-10

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]