SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000380840-11 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000380840-11
Domain Number 1 Region: 284-341
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.13e-22
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 2 Region: 648-705
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.94e-22
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 3 Region: 509-565
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.34e-21
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 4 Region: 340-397
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.16e-21
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 5 Region: 228-285
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.03e-21
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 6 Region: 397-453
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.09e-20
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 7 Region: 564-621
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.7e-20
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 8 Region: 704-761
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.36e-19
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 9 Region: 3-51
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.23e-18
Family KRAB domain (Kruppel-associated box) 0.00066
Further Details:      
 
Domain Number 10 Region: 453-509
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.88e-17
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 11 Region: 750-802
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000639
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 12 Region: 186-238
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000182
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 13 Region: 611-643
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000285
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Weak hits

Sequence:  HGL_H00000380840-11
Domain Number - Region: 111-148
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00261
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000380840-11
Sequence length 806
Comment ZNF709 (Homo_sapiens) zinc finger protein 709
Sequence
EEVSFEDVAVNFTMEEWALLDPSQKKLYRDVMWETFRNVADIGKNNILSHLCSKRALVIA
YQFYTSVNIKPVGTKPNESFGSINPLIGHSSLNVPIIANTGFKSSEYQGFEENLSSCNKY
GKICTDFQSSQKHVKTNPGEKPYEYKQYELYSYSTEGTNTEENPFVDEQDVKVCTTNYVQ
IWERNHSGVNIYICTQCGKGFNSHQFIQMHERAHIGKKLYVSKHSGKSFTNSTSFGNHQR
THIGEKPYLCKHCGKAFSTHSDCQRHERTHTGEKPYECKQCGKAFRTHSDCQRHQRTHTG
EKPYECKQCGKAFRTHSDCQRHERTHTGEKPYVCKQCGKAFSTHSDCQRHERTHTGEKLY
ECKQCGKAFSTHSNCRIHERIHTGEKPYVCKHCGKGFSRLGTCRIHERTHTGEKPYVCKQ
CGKGFSRLGTCRIHERTHTGEKPYVCKQCGKGFIRHSHCQIHESTHIGEKLNECKQCGKA
FSTHSDCQRHERTHTGEKLYVCKQCGKGFKTHSDCQRHERTHTGEKPYVCKQCGKAFSRH
GNCQMHERTHTGEKPYACKQCGKAFSRHGACQIHERTHTGEKPYICKQCGKAFSRHSHCQ
IHERTHIGDKPYECKQCGKAFSTHSDCQRHERTHTGEKLYVCKQCAKAFSTLSSCRTHER
THTGEKPHVCKQCGKAFSTRSHCRIHERIHTGEKPFVCKQCGKAFSTHSNCQVHERTHTG
EKPYVCKQCGKAFSTPGCCRKHERTHSRVKPYVCKQCGKAFTTQRYCRIHERTHTGQKSY
ECKQCGKAFTTQRYCQEHEKTHWRET
Download sequence
Identical sequences G5BEV5
HGL_H00000380840-11

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]