SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000380840-13 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000380840-13
Domain Number 1 Region: 476-533
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.05e-23
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 2 Region: 364-421
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.45e-22
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 3 Region: 616-673
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.6e-22
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 4 Region: 560-617
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.02e-22
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 5 Region: 308-365
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.43e-22
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 6 Region: 420-477
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.33e-21
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 7 Region: 1-52
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.5e-19
Family KRAB domain (Kruppel-associated box) 0.00055
Further Details:      
 
Domain Number 8 Region: 258-309
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.07e-18
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 9 Region: 523-555
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000156
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 10 Region: 214-266
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000157
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Weak hits

Sequence:  HGL_H00000380840-13
Domain Number - Region: 150-191
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0159
Family Classic zinc finger, C2H2 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000380840-13
Sequence length 687
Comment ZNF709 (Homo_sapiens) zinc finger protein 709
Sequence
PVTFEDVAVNFTMQEWALLDPSQKKLHRDVMWENFRNVAAVGRNWNDEQIEDEYKNYRKN
LRSAEVDKCCPYKLWYQHGEKVFMTPDTNVHMKLLGIKPGENLSCRKPLIAHSSPTVPVI
HNTGFKSYELHGFEQKLSNCNRQEKTTDFQSFQKHEKTNREEKFYEYKQCGRSYPDSTEG
NNAEEKSFVCKQDMRPFSTPNYAQIQERNDSRLKTYVCVQCGKSLNSNHDIQKHERAHTG
TKSYVYKQSWKSLNNNISFGNHERTHIGRKPYVCNQCGKAFSTQSNCQRHEQTHTGEKSY
VCKQCGKAFSKQSYCKIHERTHTGEKPYACRQCGKTFSTQSHCQRHERTHTGEKPYVCKQ
CGKAFNTQSDCKIHERTHTGEKPYVCNQCGKAFSTQNHCQRHERTHTGEKPYVCKQCGKA
FRTQSGCKIHERAHTGEKPYVCKQCGKAFRTQSGCKIHERAHTGEKPYVCKQCGKAFTTY
SSCQIHQRTHTGEKPYVCNQCGKAFSTNSSCQIHERTHTGEKPYICNQCGKAFSTHSECK
IHERIHTGEKPYICKQCGKAFRTQGDYKKHERTHTGEKPYVCKQCGKAFRRHGVWKIHER
THTGEKPYVCKQCGKAFSTHSSCHIHERTHTGEKPYACNQCGKAFSRHSEYKIHERTHTG
EKPYVCKQCGKAFGTQCKKHGRIHWGE
Download sequence
Identical sequences G5BIN0
HGL_H00000380840-13

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]