SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000380840-14 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000380840-14
Domain Number 1 Region: 466-523
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.48e-21
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 2 Region: 354-411
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.37e-20
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 3 Region: 298-355
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.3e-20
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 4 Region: 410-467
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.05e-20
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 570-622
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.57e-18
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 6 Region: 510-568
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.53e-17
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 7 Region: 246-299
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.76e-17
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 8 Region: 2-37
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000131
Family KRAB domain (Kruppel-associated box) 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000380840-14
Sequence length 642
Comment ZNF709 (Homo_sapiens) zinc finger protein 709
Sequence
MEEWALLDPSQKELHRDVMWENFRNVAAVGRNWDNQQQIEDEHQNYRKNLRSAEVDKCCQ
YKLWYQCGEIVFMTPDTNVHMNLLGIKLGESLACRKPLIGHSSPTVPIIHNTGLQSYELH
GFEQKLSNCNRHGKTSTDFQSFQKHAETNPEEKLYGYKQCAKSYSECTEGSNTEEKSFVY
NQDVRPFSSPNYDKIQERNDSRVNTYTYIKWGKSLNSHHDIQKHERAHTAVDSYVYKHSW
KLLNNKTSFGSHERTHIMGKPYVCKQCGKAFSKQSHCQIHERTHTGEKPFVCKQCGKAFR
THQGCQGHERTHTGDKPYVCKQCGKAFRTQSTCQTHERTHTGEKPFVCKQCGKAFRTHQG
CQIHERIHTGEKPYVCKQCGKAFRTYQVCQGHERTHTGEKPYVCKQCGKAFRSQSTCKTH
EKTHTGEKPFVCKQCGKAFRTHDNCQSHERTHTGEKPVVCKQCGKAFRTQSNYKTHERTH
SGEKPFVCKQCGKAFRVHQACQRHERTHTGEKPFVCKQCGKAFRTHQGCQGHERTHTGEK
PFVCKQCGKAFKTHSSYQIHERIHIGEKYSHCKTHERTHTGEKPYVYNQCRKAFRRQSHC
KTHERIHTGEKPYACNQWGKAFRTQSHYKIQERTHWGETLYM
Download sequence
Identical sequences G5BN36
HGL_H00000380840-14

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]