SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000380840-15 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000380840-15
Domain Number 1 Region: 335-392
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.39e-22
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 2 Region: 279-336
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.38e-22
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 3 Region: 223-280
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.4e-21
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 4 Region: 391-448
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.55e-21
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 5 Region: 2-52
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.35e-20
Family KRAB domain (Kruppel-associated box) 0.00045
Further Details:      
 
Domain Number 6 Region: 433-485
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000277
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 7 Region: 177-224
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000102
Family Classic zinc finger, C2H2 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000380840-15
Sequence length 486
Comment ZNF709 (Homo_sapiens) zinc finger protein 709
Sequence
EAVTFEDVAVNFTMEEWALLDPSQKKLYRDVMWENFRNVAAIGRNWDDQQIEDEYKNCRR
NLRSEGEKCCQYKLCQQHGETFFWTPDTNVHMKVVGTKPGESFAYRKPLINHSLSNVPIM
ANTRLESYECQGFKEMLSNKHGNTSTAFQSFQKQTKANPRNKPYEYKQGGKSYSTDIERS
NTEEKPFVYKQDMKAFSTTNFVQICERNHSEVNTYVCIQCGKAFNSLHDIQIHERAHTGE
KPYVCKQCGKAFRTHSNCQIHERTHTGERPYICKQCGKAFRTHSNCQIHERTHTGEKPYV
CKQCGKAFSRQDNCQTHERTHTGERPYICKQCGKAFRTYSHCQKHERTHTGEKPYVCKQC
GKAFSRQGNCQKHERLHTGEKPYVCNQCGKAFSTLGNCQIHERTHTGEKPYVCKQCGKAF
RTHGNCHIHERTHTGEKPYVCKQCGKAFSRRCTYQKHERIHTRSNPYVSKQCGKAFNTHG
NCQIHE
Download sequence
Identical sequences G5BPJ1
HGL_H00000380840-15

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]