SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000380840-19 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000380840-19
Domain Number 1 Region: 301-358
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.71e-21
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 2 Region: 357-414
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.01e-21
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 3 Region: 245-302
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.4e-20
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 4 Region: 413-470
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.78e-20
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 5 Region: 2-52
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.57e-17
Family KRAB domain (Kruppel-associated box) 0.00074
Further Details:      
 
Domain Number 6 Region: 455-507
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.81e-17
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 7 Region: 193-246
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.99e-17
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Weak hits

Sequence:  HGL_H00000380840-19
Domain Number - Region: 117-167
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000189
Family Classic zinc finger, C2H2 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000380840-19
Sequence length 517
Comment ZNF709 (Homo_sapiens) zinc finger protein 709
Sequence
EAVIFEDVVVRFTMEEWDLLNPSQKKLYRDVMGETFRNMAAVGRAWDNQELEDEHKTYWR
NLRNKAWNQYKEIFLWTPDANMDMKNTGLKPAESLTHRKPLIGHLSLDVPIITHTALKPC
EYLGYEEKLCKHNEHGRTCSDFQSCQKHARTKAGEKPYEGGQCGKSYPDLSEGTHLREKT
SLCKKTLKASSTPNDVQIHERNHSGGKCYVCKQCGKAFTRHSACKIHERIHMGKKPYVCK
QCGKAFSTQGYCKIHERRHTGEKPYLCKQCGKAFSTRRYCEIHERTHTGEKPYVCKQCGK
AFSAQSYCKIHERIHTGEKPYVCKQCGKAFSRHRTCKIHERNHTGEKPYACKQCGKAFST
RCAFQIHERSHTGEKPYVCKQCGKAFSTHIHCQRHEQIHTGEKPYMCKQCGKAFSTRGAC
QRHERSHTGEKPYVCKQCGKAFSSKGYCKIHERSHTGEKPYVCKQCRKAFSTRFYCERHE
RTHTGEKPYVCKQCGKAFSTKYYCKVHERNHIGEKSY
Download sequence
Identical sequences G5BT76
HGL_H00000380840-19

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]