SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000380840-23 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000380840-23
Domain Number 1 Region: 407-464
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.25e-22
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 2 Region: 239-296
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.79e-22
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 3 Region: 463-520
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.15e-21
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 4 Region: 295-352
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.06e-20
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 5 Region: 2-48
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.45e-20
Family KRAB domain (Kruppel-associated box) 0.00091
Further Details:      
 
Domain Number 6 Region: 520-576
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.43e-19
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 7 Region: 352-408
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.5e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 8 Region: 617-669
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.27e-19
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 9 Region: 575-632
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.39e-17
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 10 Region: 201-253
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000347
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 11 Region: 142-186
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000471
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000380840-23
Sequence length 670
Comment ZNF709 (Homo_sapiens) zinc finger protein 709
Sequence
EAVTFEDVAVNFTMEEWALLNPSQKNLYRDVMGETFRNMVSIGQFITAKPWNQPRCPSVD
PWIKKNFEVFENREEWRGNEELEQYYQYKTWNQYKEIFLWIPDANVDMKLVGLKPIESLA
CRKPLIEDLSLNVPHTALKPDEYLGSEEKLLKCNENARNWSNFQSFQKHTRTKAGEKPCE
FGQCGKSSSDLSERTHLREKKTFVCKKNLKDSRTTSDIQIHERNHSGGKPYVCKQCGKAF
STQSYCKIHERIHTGEKPYVCKQCGKAFSTHSVCRIHERSHTGEKPYVCKQCGKAFSTQG
YCKIHERTHTGEKPYICKQCGKAFNTRDYCQRHERSHTGEKPYICKKCGKCFSTHKNCKI
HEISHTGEKPYVCKQCGKAFSTPDYCKIHERSHTGEKPYVCKQCGKAFSRNSHCQIHERS
HTGEKPYVCKQCGKAFSTHSVCRVHERTHTGEKPYVCKQCGKAFSSNSHCRTHERIHIGE
KPYVCKQCGKAFRTCDAIQIHERTHTGEKPYVCKQCGKAFATCGGIQKHKRSHTGEKPYA
CKQCGKAFRWHNECKIHERIHTGEKPYVCKQCEKAFRCHRDCQRHERNHTEEKTYVCMQC
GKAFSTQGYCKIHERSHTGEKPYVCMQCGKAFSTRNYCRIHERTHTGEKPYVCKQCGKGF
ATKSSLHRHK
Download sequence
Identical sequences G5C0F6
HGL_H00000380840-23

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]