SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000380840-24 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000380840-24
Domain Number 1 Region: 480-537
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.38e-22
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 2 Region: 309-366
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.09e-22
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 3 Region: 253-310
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.07e-21
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 4 Region: 592-649
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.65e-21
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 5 Region: 2-52
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.44e-20
Family KRAB domain (Kruppel-associated box) 0.00048
Further Details:      
 
Domain Number 6 Region: 424-481
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.09e-20
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 7 Region: 536-593
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.69e-20
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 8 Region: 353-414
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.39e-18
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 9 Region: 634-686
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.26e-17
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 10 Region: 217-267
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000643
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Weak hits

Sequence:  HGL_H00000380840-24
Domain Number - Region: 183-232
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.002
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000380840-24
Sequence length 692
Comment ZNF709 (Homo_sapiens) zinc finger protein 709
Sequence
AVTFEDVAVNFTMEEWALLDPSQKKLYRDVMWENFRNVASIGRNWDNQQIEDEYKNYWEN
LRNAEVVNLWYQHGKMVFVTPDTDVHMKLPGIKPSESPACGKPLIGHSSPTVPIINNTRL
QSYELHGLEQKLSNCDRHGKTSTHFQYLEKHAKTNPEEKPTGYKQDVRPLSTPNYVQTLK
RNHRRMNTYICIQRGKGLNSHRDTQKHKRTHNGTESYANKHCLKSLNNDTSLTNPERLHT
GRKLYVCKQCGKAFTAQNNYKIHERTHTGEKPYVCKQCGKAFRAQNYCKMHERTHTGEKP
YVCKQCGKAFTRHNQCKIHERTHTGEKPYVCKQCGKAFIRQSQCKIHERTHTGEKPYVCN
QCGKAFIRQSQCKMHERTHTGEKPYVCKYCVKAFIRHSQCKIHERTHTGERPYKPYVCNQ
CGKAFIRQSQCKMHERTHTGEKPYVCKYCVKAFIRHSQCKIHERTHTGERPYVCKQCGKA
FTTQSDYQRHERTHTGEKPYVCKHCGKAFIRHSQCKIHERTHSGEKPYVCNQCGKAFKTQ
GYCKIHERTHTVEKPYVCKQCGKSFRTHISCKIHERIHTGEKPYVCKQCGKAFTALSYCK
VHEKTHTGEKPYVCKQCGKAFSARNNCQKHERTHTGEKPYVCKQCGKAFTTRDNCQNHER
THTVEKLYACKQCGKTFSTHRNCQRHGRYHTV
Download sequence
Identical sequences G5C0X1
HGL_H00000380840-24

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]