SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000380840-25 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000380840-25
Domain Number 1 Region: 365-422
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.93e-22
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 2 Region: 477-534
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.54e-21
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 3 Region: 421-478
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.26e-21
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 4 Region: 1-57
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.97e-20
Family KRAB domain (Kruppel-associated box) 0.00055
Further Details:      
 
Domain Number 5 Region: 523-575
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.14e-16
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 6 Region: 309-366
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.42e-16
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 7 Region: 268-319
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000013
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Domain Number 8 Region: 200-252
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000666
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 9 Region: 133-175
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000195
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000380840-25
Sequence length 581
Comment ZNF709 (Homo_sapiens) zinc finger protein 709
Sequence
QDPVTFEDVAVNFTIEEWALLKPSQKKLYRDVMWETFKNMTVIGRTWDNQQIEQTYKNCS
RNLRNEEVVKCHQYKAWKQQEEIFLWTPDANRDRQQAPLPESLACKEPLIGHLTLNVPII
AHTGLKSDDYLGFEEKLYKCNDHGKTCSDFQSFQKHTRTKTGEKPYQYEQCAKAYSDLSE
RPQPGEKTSVGKKNVKASSTPSGVQIHEGKHSGENPYVCKQCGKAFFSSYHIQVHERKHT
GEKTYVSKECVKALAHNNSFHRPKSIQTGVKPYVCKQSGRAFTAHSYCKIHERSHIGEKP
YVCKQCGKAFITQRAYKTHERNHTSEICYVCKQCGKEFTHKSTYHRHTRSHTGEKPYVCK
HCGKAFRTHSHCQRHERIHTGERPYVCKQCGKAFITHNHFQIHERTHTGEKPYVCKQCGK
SFSQRTNCHIHERIHTGEKPYVCQQCGKGFAVKSTFHRHGRSHTGEKPYVCQQCGKAFST
LSQCRIHESIHTGEKPYVCKQCGKAFSTLSQCRIHESIHTGEKPYVCKQCGKAFSTLSHC
RRHESIHTGEKPYVCKQCGKAYTTQKYFKKHERSHTEEKLH
Download sequence
Identical sequences G5C0W5
HGL_H00000380840-25

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]