SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000380840-29 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000380840-29
Domain Number 1 Region: 261-318
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.41e-22
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 2 Region: 429-486
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.48e-22
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 3 Region: 596-653
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.96e-21
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 4 Region: 317-374
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.22e-20
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 5 Region: 373-430
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.57e-20
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 6 Region: 155-206
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.09e-20
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 7 Region: 2-55
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.72e-20
Family KRAB domain (Kruppel-associated box) 0.00058
Further Details:      
 
Domain Number 8 Region: 205-262
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-19
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 
Domain Number 9 Region: 485-542
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.77e-19
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 10 Region: 638-690
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.36e-18
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 11 Region: 558-610
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.94e-17
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000380840-29
Sequence length 694
Comment ZNF709 (Homo_sapiens) zinc finger protein 709
Sequence
EAVTFEDVAVNFTMEEWTLLNPSQKKLYRDVMRETFRNLAAVGRAWDNQEVEEEYKNYWR
NLRNEEVEKCYQNKGWNQCEEMFLWTPVANVDMKQAALKPAESLACRKPLSEHLSLNEPI
IAHAALKTSGYLGSEGKLYKWNARFKDKDWRDTLCCKIHERIHTGEKPYACKQCGKAFSR
HSHCQIHERTHTGEKPYICEQCGKAFSTQRYCKIHEKSHTGENPYVCKQCGKAFSTQGYC
KIHERNHTGEKPYVCKQCGKAFSTQDYCKIHERIHTGEKPYVCKQCGKAFSTHRDLQKHE
RTHTGEKPYVCKQCGKAFSTQGCCKIHERIHTGEKPYVCKQCGKAFSTQRYCKKHEKIHT
GEKPYVCKQCGKAFITQGCCKIHERIHTGEKPYVCKQCGKAFITQRCCKIHERIHTGEKP
YVCKQCGKAFITQSCCKIHERIHTGEKPYVCKQCGKAFSTHSDRQKHERTHTGEKPYVCK
QCGKAFITQSCCKIHERIHTGEKPYVCKQCGKAFITQRCCKIHERTHTGVKSYICKQCGK
AFSKQDYCKIHERHHTEKPYVCKQCGKAFSQHEHCKQHERYHTGEKPYVCNQCGKAFSTH
SYCQIHERTHTGEKPYVCKQCGKAFSTQSYCKIHERNHTGEKPYVCKQCGKAFSTQHYCK
IHERIHTGEKPYVCKQCGKAFSTQSYCRIHERTH
Download sequence
Identical sequences G5C799
HGL_H00000380840-29

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]