SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000380840-3 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000380840-3
Domain Number 1 Region: 306-362
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.03e-20
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 2 Region: 196-248
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000121
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 3 Region: 263-315
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000156
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 4 Region: 2-56
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000000301
Family KRAB domain (Kruppel-associated box) 0.0019
Further Details:      
 
Domain Number 5 Region: 141-186
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000033
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Weak hits

Sequence:  HGL_H00000380840-3
Domain Number - Region: 73-114
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00763
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number - Region: 355-378
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0486
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000380840-3
Sequence length 379
Comment ZNF709 (Homo_sapiens) zinc finger protein 709
Sequence
EEAVTLEDVAVNLTKVEWASLNPPQKKLYRDVMWEAYMHMTAIERTCGNQQIRTVYKNCS
RNVRNDADKYLRFEEILYKCSEHGKTCSDFQSFQKREMRKTGEKQCQYEQRGKPYSDFSE
QIHLGEKTFLGKKNVKASSTPSVVQTQERNHGVGSPYVHKQCEKTFMSSYNIQVNERIHA
GEKTYVTKDFVKPLSHSHSFHKHKIIYTGQKPYVCKQCGKTFTTQSYYEIHEENHTRNKP
YVCEQCGKALNTCGQCHSRERTHTREKPCLCKQCGKGFADKFSFERHRAIHTGKKPYVCK
YCGKFFTQKRNCQIHERIHTGEQPYICKQCGKAFRTHSHCQSHERTHTGEKPFVCRHCGK
SFNRKCDCQIHERIHTGEK
Download sequence
Identical sequences G5AK85
HGL_H00000380840-3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]