SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000380840-30 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000380840-30
Domain Number 1 Region: 476-533
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.55e-22
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 2 Region: 336-393
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.8e-22
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 3 Region: 588-645
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.2e-22
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 4 Region: 644-701
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.01e-21
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 5 Region: 532-589
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.09e-21
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 6 Region: 420-477
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.4e-20
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 7 Region: 280-337
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.19e-20
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 8 Region: 224-281
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.29e-17
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 
Domain Number 9 Region: 1-54
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.28e-16
Family KRAB domain (Kruppel-associated box) 0.00065
Further Details:      
 
Domain Number 10 Region: 162-211
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000329
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 11 Region: 383-415
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000358
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Weak hits

Sequence:  HGL_H00000380840-30
Domain Number - Region: 118-174
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000665
Family Classic zinc finger, C2H2 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000380840-30
Sequence length 702
Comment ZNF709 (Homo_sapiens) zinc finger protein 709
Sequence
VTFEDVAVNFTLEEWVLLNSSQKKLYRDVMSEIFKNLAAIEPNWNGQQIENQCKCWRRNL
RSEEIEEWCQYKLWYQHEDMFFGTPDRNVNMKPLFTEPTERIACRNRLILPSSLNVPFIT
HTALKSYEYQKFEEKLSNKNEHGETYRDFQSFQKDARTNPREKTYECKQCEKSFSDCIKE
THIGEKPTVCKQDAKAFSTTSYFQIHENNHSEMNVSVCIQTGKAFNSHRSVQIHERAHTG
EKPHVCKQCGKAFTNNSSFCRHERTHKVEKHYVCKQCGKAFTDRSSFCRHERSHTGEKPY
VCKQCGKGFSTHSYCQKHEKIHKGEKPYVCKQCGKAFSTQSNCQTHERIHTGEKPYVCKQ
CGKAFRQHIQCQIHERTHTGEKPYVCKQCGKAFSRNRYCQIHERTHTVQKPYVCKQCGKA
FTYDSSLYKHKKIHTGEKLYVCKQCGKAFTCHSHCETHERTHTGEKPYACKQCGKAFLYY
SSFCKHKRIHTGEKPYVCKQCGKAFTYDSSLRKHKIIHTGEKPYVCKQCGKAFPYHTSFH
KHKRIHTGEKPYICKQCGKAFAYDSSFYKHKRIHTGEKPYVCKQCGKAFSTLIQCQSHNR
THTGEKPYVCKQCGKAFTYDSSLCNHRRIHTGEKPYVCKQCGKAFTSHSNCQTHERSHTG
EKPYVCKQCGKAFPYYSSFYIHKRIHSGEKPYVCKQCGKAFS
Download sequence
Identical sequences G5C7M0
HGL_H00000380840-30

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]