SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000380840-33 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000380840-33
Domain Number 1 Region: 361-418
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.74e-20
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 2 Region: 417-474
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.39e-20
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 3 Region: 305-362
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4e-20
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 4 Region: 473-530
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.49e-20
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 5 Region: 249-306
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.83e-19
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 6 Region: 2-53
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.62e-18
Family KRAB domain (Kruppel-associated box) 0.00042
Further Details:      
 
Domain Number 7 Region: 515-567
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.89e-18
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 8 Region: 194-250
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000695
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 9 Region: 147-194
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000925
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000380840-33
Sequence length 578
Comment ZNF709 (Homo_sapiens) zinc finger protein 709
Sequence
AVTFEDVAVTFTMEEWALLDSSQKKLYRDVMWETFSNVSAIGRNWDDQQIEDEWQQCWRK
NLRCEEVVEGHQNKSWHQHEEMLFWTPDSDVNMKLPVSNPVENLVCRKPLISHSLLDVPI
TAHTVLKSYECQGFEDKLSNYSVHDFQFLQRHASINTGERPYEYKQCGKAYSDCNVDTHT
GEKPLVCKEDSNTFGLPNYVQIYERNHSGVHPYVYTQCGKAFNSHDYIQIQERPHNGEEH
YVCKQCQKSFTSNTSFCTHERTHSKEKPYVCKHCGKAFGKPSNCRIHEKTHIGEKPYVCK
QCGKAFSTHKYCQIHERNHTGEKPYICKHCGKAFNFKSNCKIHEKIHTGEKPYLCKQCGK
AFTRHSDCQIHEKTHTGEKPFVCKQCGKAFRTYKYCKIHERNHTGEKPYICEQCGKAFTC
KSSICTHKRTHTGEKPYVCKQCGKAFSTHKYCQIHERNHSGEKPYVCEQCGKAFNCKSSF
CKHKRTHTGEKPYVCKQCGKAFRTQSDCHIHEKIHTGQKPYLCKHCGKAFSRHSNCQIHE
RIHTGEKPYVCNQCGKAFTDNSSFCKHKKIHCNETLCM
Download sequence
Identical sequences G5C887
HGL_H00000380840-33

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]