SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000380840-4 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000380840-4
Domain Number 1 Region: 392-449
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.21e-22
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 2 Region: 336-393
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.61e-19
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 3 Region: 280-337
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.5e-19
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 4 Region: 2-46
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.92e-19
Family KRAB domain (Kruppel-associated box) 0.00072
Further Details:      
 
Domain Number 5 Region: 434-486
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.77e-18
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 6 Region: 225-281
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.76e-18
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 7 Region: 188-238
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000762
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 8 Region: 134-175
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000738
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000380840-4
Sequence length 495
Comment ZNF709 (Homo_sapiens) zinc finger protein 709
Sequence
EAVTFKDVAVNFTMEEWALLNPSQKKLYRDVMRETFRNMTAIGTVWDQKVGEEYKNYWRN
LRNEEVEKCYQSKDWNECEEIFLYTPDANVDKEQAGLKPPEGLACKKPLTGHLSLNVAIT
AHTGVKPSECLGWEEKLHKCNENGRTCGDLQSFQKDARTETGEKPYEYNQCGKSYHYLSE
RTHLRETFVCKKNLNASSISSDVRIHERNHNGGKLYVCKQCGKAFQSQGYCNIHKRTHTG
EKLYGCKQCGKAFSSRGCCNLHEKTHTEEKPYVCKQCGKAFSTQVYCQRHKRNHNGEKPY
VCKQCGKAFSTQVYCQRHKRNHNGEKPYVCKQCGKAFSTQVYCQRHKRNHNGEKPYVCKQ
CGKAFSTQVYCQRHKRNHNGEKPYVCKECGKAFSIQIYCKNHERIHTGEKPYVCKQCGKA
FSIQSYCKNHERIHTGEKPYVCKQCGKAFSTRDYCKIHERIHTGEKPYACKHCGKAFLRS
SKCQRHEKIHTGEKP
Download sequence
Identical sequences G5ALW4
HGL_H00000380840-4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]