SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000380840-5 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000380840-5
Domain Number 1 Region: 470-527
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.67e-22
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 2 Region: 526-583
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.17e-21
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 3 Region: 414-471
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.39e-20
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 4 Region: 321-381
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.38e-19
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 5 Region: 2-52
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.05e-19
Family KRAB domain (Kruppel-associated box) 0.00058
Further Details:      
 
Domain Number 6 Region: 568-620
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.55e-18
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 7 Region: 266-325
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.47e-16
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 8 Region: 373-409
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000228
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 9 Region: 202-248
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000529
Family Classic zinc finger, C2H2 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000380840-5
Sequence length 630
Comment ZNF709 (Homo_sapiens) zinc finger protein 709
Sequence
EAVTFEDVAVNFTAEEWALLDPSQKKLYRDVMWETFRNVTAIERNCNDQQVEDEYKSCRR
NRRSEEVDKWYQHELWYQHEDMMFCSPDGNVYMKTVGTKRSESFAYRKHLIFHSPENVPG
LKLYEYQSFQEKLSNCSTHEEACTEFQYFQKYAKKTPGEKACGYKQSGTFSDGTEGTNIE
EEKPFEYKQDVQAVSALNYVEIRKRHHNRVDPYVSVQSGKGFDSHHDVQMHESAYTGEKH
YECKNSGKSLTNSSSFCKFKRGETEEKHYVCKHCGKAFGTPFTCQNHERIHTGEKPYVCK
QCGKAFGTQFNCENHEKIHTGEKRYVCRQCGRAFGTKFNCENHEKIHTGEKPYVCDQCGK
AFSRHSHFQIHIRIHTGEKPYVCKQCEKGFSTHSHCKRHERTHTGEKPYQCGKAFITHSH
CKIHERTHTGEKPYICKHCGKAFITHGSCQIHERIHTGENPYVCKQCGKTFGTYSHCKRH
EKIHTGEKPYVCQQCGKAFSRHSHFQIHIRTHTGEKPYICKQCGKAFITHSHCKIHERTH
TGEKPYVCKYCGKAFSAQGNCHNHEKIHTGERPYVCDQCGKAFSRLSHCKIHERTHTGEK
PYVCKQCKKGFISKDSCKRHEMTHTGKKTY
Download sequence
Identical sequences G5ARN9
HGL_H00000380840-5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]