SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000380840-8 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000380840-8
Domain Number 1 Region: 414-471
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.77e-22
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 2 Region: 190-247
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.11e-22
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 3 Region: 588-645
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.38e-19
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 4 Region: 2-48
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.81e-19
Family KRAB domain (Kruppel-associated box) 0.00083
Further Details:      
 
Domain Number 5 Region: 470-527
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.06e-18
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 358-415
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.24e-18
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 7 Region: 137-191
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.28e-17
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 8 Region: 514-574
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.55e-17
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 9 Region: 303-359
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.65e-16
Family Classic zinc finger, C2H2 0.0097
Further Details:      
 
Domain Number 10 Region: 630-682
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000342
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 11 Region: 232-284
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000488
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 12 Region: 78-133
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000321
Family Classic zinc finger, C2H2 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000380840-8
Sequence length 685
Comment ZNF709 (Homo_sapiens) zinc finger protein 709
Sequence
EAVTFEDVAVNFTKEEWAFLDPSQKKLYRDVMWETLRNLAAIGRSSGDQQIEDEYKTWSK
SLSHSEMNTYACIPCGKSFNSHHDIQTHEKAHTGGEVCVGKHCGKFFMNNNSFGNHEGTH
TVERPSVCKQCGKVCRKNSHCQIHGRTHTGEKPYVCKHCGKAFNTHSYCKKHEQIHTGVK
PYTCKHCGKAFRRNSHCRVHERIHTGERPYVCKHCGKAFRRNSHCQVHERIHTGEKPYAC
KQCGKAFRSHANCHTHEQTHIVEKPYVCKQCGKAFRSQANCHTHEQIHIVEKPCVCKQCE
KGFGTHSQCQNHERIQSGENAYVCKQCGKAFRTYSHYQNHEGMHKGDKPYVCKQCGKAFS
THSYCQRHEGTHTMEKPYVCKQCGKAFSTHSYCQRHEQTHTMEKPYVCKQCGKAFSRRES
WQIHERIHTGEKPYVCEQCGKAFITRGACARHELTHTGEKPYVCRQCGKAFRTRADCHSH
EQIHTGEKPYVCKQCGQAFSTRGTCRGHERSHTGEKPYVCRLCGKAFRIRADCRTHEQIH
TGEKPYVCKQCGKAFSTQSYCRRHERAHTMKKPYVCEKPYVCEQCGKAFHTHGGYTLHKC
THTGEKPYVCRQCGKAFRTCMVCKIHERIHTGEKPYVCKQCGKAFSTHSYCQRLEGTYTM
EKPYVCTQCGKAFSRRESWQIHERT
Download sequence
Identical sequences G5BBT5
HGL_H00000380840-8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]