SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000380840-9 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000380840-9
Domain Number 1 Region: 581-638
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.52e-21
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 2 Region: 525-582
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.67e-21
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 3 Region: 245-302
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.38e-21
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 4 Region: 133-190
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.19e-20
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 5 Region: 470-526
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.2e-20
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 6 Region: 414-470
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.05e-19
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 7 Region: 189-246
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.32e-19
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 8 Region: 358-414
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.07e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 9 Region: 623-675
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.59e-18
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 10 Region: 289-349
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.62e-18
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 11 Region: 2-36
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000589
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 12 Region: 81-134
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000851
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000380840-9
Sequence length 686
Comment ZNF709 (Homo_sapiens) zinc finger protein 709
Sequence
MEEWALLDPSQKKLHRDVMWENFTNVTAIGRNWDNQQQIEDKYQNFRKTLSSPNYDKIQE
RNDSRVNTYTYIKWGKSLNSHYDIQKHERAHTGADFYVYKHSWKLLNNKTSFGSHERTHI
MGKPYICKQCGKAFSKQSHCQIHERTHTGEKPFVCKQCGKAFRRHDNCHSHERTHTGEKP
FICKQCGKAFRRHDNCHSHERTHTGEKPFICKQCGKAFRRHDNCHSHERTHTGEKPFVCK
QCGKAFRTQSNYKTHERTHTGEKPFQCKQCGKAFRRQQECQRHEQTHTGEKPFVCKQCGK
GFRTHQGCQGHERTHTGEKPFVCKQCGKAFRTHQGCQRHERIHTGEKLYVWVSCGKAFGT
QGNCKTHERSHTLEKPYVCEQCGKAFNTHSSYHIHERIHTGEKLYVCKQCGKVFGTQSKC
KTHESTHTGEKPFVCKQCGKAFRTHVNCQSHERIHTGEKPFVCKQCGKAFGTQGNCKTHE
KTHTGEKPYVCEQCGKAFRTLQVCQGHERTHTGEKPFVCKQCGKAFRTQSNCKTHEMTHT
GEKPYVCKQCEKAFRRQSHCQRHERTHTGEKPYVCKQCGKAFTTHSYWQIHERAHTGQKP
YVCKQCGKAFRRQSHCKIHEMIHTGEKPYACNQCGKAFRRQSHCKIHEMIHTGEKPYACN
QCGKAFSTHRNCQGHERNHSVETLCM
Download sequence
Identical sequences G5BD93
HGL_H00000380840-9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]