SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000380921-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000380921-1
Domain Number 1 Region: 269-350
Classification Level Classification E-value
Superfamily SH3-domain 3.41e-24
Family SH3-domain 0.00046
Further Details:      
 
Domain Number 2 Region: 101-160
Classification Level Classification E-value
Superfamily SH3-domain 1.29e-21
Family SH3-domain 0.0006
Further Details:      
 
Domain Number 3 Region: 4-65
Classification Level Classification E-value
Superfamily SH3-domain 2.36e-20
Family SH3-domain 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000380921-1
Sequence length 665
Comment SH3KBP1 (Homo_sapiens) SH3-domain kinase binding protein 1
Sequence
MVEAIVEFDYQAQHDDELTISVGEVITNIRKEAGGWWEGQINGRGGLFPDNFVREIKKDM
KKDPLSNKAPEKPMHDVFSGNSLLSSETILRTNKLGERRRRRCQVAFSYLPQNDDELELK
VGDIIEVVGEVEEGWWEGVLNGKTGMFPSNFIKELSGESDELGISQDEQLSKSSLRQTTG
SESDGGDSSSTKSEGANGTVAAAAIQPKKVKGVGFGDIFKDKPIKLRPRSIEVENDFLPI
EKTIRKKLPPTTATPDLSKTEMDSRTKTKDYCKVIFPYEAQNDDELTIKEGDIVTLINKD
CIDIGWWEGELNGRRGVFPDNFVKLLPPDFDKEGNRPKKPPPPSAPVIKQGAGTTERKHE
IKKIPPERPETLPNRTEEKERPEREPKLDLQKPSVAAIPPKKPRPPKTNSLNRPGALPPR
RPERPVGPLMHTRGDSPKIDLVGSTLSSILDKDLSDHSNDIDLEGFDSMVSSTEKLSHPT
TSRPKATGRWPPSQSLTSSSLSSPDIFDSPSPEEDKEEHISLAHRGLDVSKKTSKTITIS
QVSDNKASLPPKPGTIAASSGGPASLSSAVSSPLSSSLGTAGHRANSPSLFGTEGKPKME
PAASSQAAVEELREQVRELRSIIETMKDQQKCEIKQLLSELDEEKKMRLRLQMEVNGIKK
ALQSK
Download sequence
Identical sequences G5BQ96
HGL_H00000380921-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]