SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000380948 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000380948
Domain Number 1 Region: 412-655
Classification Level Classification E-value
Superfamily vWA-like 7.51e-85
Family Integrin A (or I) domain 0.000000366
Further Details:      
 
Domain Number 2 Region: 280-396
Classification Level Classification E-value
Superfamily vWA-like 1.56e-34
Family Integrin A (or I) domain 0.0000689
Further Details:      
 
Domain Number 3 Region: 911-988
Classification Level Classification E-value
Superfamily Integrin beta tail domain 9.02e-16
Family Integrin beta tail domain 0.0048
Further Details:      
 
Domain Number 4 Region: 628-742
Classification Level Classification E-value
Superfamily Integrin domains 0.00000000000000157
Family Integrin domains 0.0021
Further Details:      
 
Domain Number 5 Region: 180-239
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000000837
Family Plexin repeat 0.0012
Further Details:      
 
Domain Number 6 Region: 825-865
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000733
Family Integrin beta EGF-like domains 0.0009
Further Details:      
 
Domain Number 7 Region: 869-908
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000419
Family Integrin beta EGF-like domains 0.013
Further Details:      
 
Weak hits

Sequence:  HGL_H00000380948
Domain Number - Region: 747-774
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0159
Family Integrin beta EGF-like domains 0.031
Further Details:      
 
Domain Number - Region: 791-816
Classification Level Classification E-value
Superfamily EGF/Laminin 0.019
Family Integrin beta EGF-like domains 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000380948
Sequence length 1059
Comment ITGB2 (Homo_sapiens) integrin, beta 2 (complement component 3 receptor 3 and 4 subunit)
Sequence
MCSDRNSRAQDPPERPAPPLEQLLSGLGTGLQANEGLSSNCSGSCQCVRPEDSSEQAQPA
PKCMAVCLGLAVPEEPAARARADLSRATCSHLVAGPGGQGPGSFEVRRDHSAAGKEQVNT
PPAQPDPAQARGASGPAPCGGKDRGPGQDRLPGTALSQDMLAPCLPPALLGLLCLGSALS
QECTKYKVSTCRDCIQSGPGCAWCQNLNFTGPGEPDSARCDTREQLLKRGCVPDDIVDPR
SLAAPQEDHAGGQKQLFPQKVTLYLRPGQAATFNVTFRRAKGYPVDLYYLMDLSYSMLDD
LINVKKLGGDLLQALNEITESGRIGFGSFVDKTVLPFVNTHPEKLRNPCPSKEEECQPPF
AFRHVLKLTNNSNQFRTEVGKQLISGNLDDPAGGLEGRAGQAATFNVTFRRAKGYPVDLY
YLMDLSYSMLDDLINVKKLGGDLLQALNEITESGRIGFGSFVDKTVLPFVNTHPEKLRNP
CPSKEEECQPPFAFRHVLKLTNNSNQFRTEVGKQLISGNLDAPEGGLDAMMQVAACQEEI
GWRNVTRLLVFATDDGFHFAGDGKLGAILTPNDGHCHLEDNMYKRSNEFDYPSVGQLVHK
LTESNIQPIFAVTQKMVTTYEKLAEIIPKAAVGELSDDSSNVVQLIKNAYNKLSSRVVLG
HSTLPDTLKVTYDSFCSNGVTHTDQPKGDCDGVQISVPVTFQVKVTATECIQAQSLDIRA
LGFTDTVTVRVLPQCECRCRDQRQNRGLCGGKGSMECGVCRCEAGYIGKSCECQTQGRSS
QELEGSSRKDNSSTVCSGLGDCVCGQCVCHTSDIPNKVIYGRYCECDNMNCERYDGQVCG
GPRRGLCDCGRCLCEPGFEGSACQCKSSTEGCLNARRVVCSGRGRCRCNTCECDMGYQPP
LCEECAVCPSPCAQHISCAECLKFVSGPFEKNCSTACGHLKPLTSAATGKSCRERDSQGC
WMTYTLRQRDGRDSYDIHVEDTRECVEGPNIAAIVGGTVAGIVLIGVLLLVVWKALTHLS
DLREYRRFEKERSKSQWNNDNPLFKSATTTVMNPKFADS
Download sequence
Identical sequences G5BMF9
HGL_H00000380948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]