SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000381216 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000381216
Domain Number 1 Region: 52-131
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.84e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000407
Further Details:      
 
Domain Number 2 Region: 149-233
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.07e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000373
Further Details:      
 
Domain Number 3 Region: 244-330
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.94e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000464
Further Details:      
 
Domain Number 4 Region: 345-417
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.14e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000381216
Sequence length 522
Comment KHSRP (Homo_sapiens) KH-type splicing regulatory protein
Sequence
QIAAKIGGDAATTVNNSTPDFGFGGQKRQLEDGDQPESKKLASQGDSIGSQLGPIHPPPR
TSVTEEYRVPDGMVGLIIGRGGEQINKIQQDSGCKVQISPDSGGLPERSVSLTGAPESVQ
KAKMMLDDIVSRGRGGPPGQFHDSANGGQNGTVQEEIMIPAGKAGLVIGKGGETIKQLQE
RAGVKMILIQDGSQNTNVDKPLRIIGDPYKVQQACEMVMDILRERDQGGFGDRNEYGSRI
GGGIDVPVPRHSVGVVIGRSGEMIKKIQNDAGVRIQFKQDDGTGPEKIAHIMGPPDRCEH
AARIINDLLQSLRSGPPGPPGGPGMPPGGRGRGRGQGSWGPPGGEMTFSIPTHKCGLVIG
RGGENVKAINQQTGAFVEISRQLPPNGDPNFKLFIIRGSPQQIDHAKQLIEEKIEGPLCP
VGPGPGGPGPAXGPFNPGPFNQGPPGAPPHAAGPPPHQYPPQGWGNTYPQWQPPAPHDPS
KAAAAAAAPNAAWAAYYSHYYQQPPGPVPGPAPAPAAPPTQG
Download sequence
Identical sequences G5C4F5
HGL_H00000381216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]