SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000381304-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000381304-1
Domain Number 1 Region: 12-73
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.31e-24
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 2 Region: 265-322
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.09e-23
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 3 Region: 321-378
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.18e-21
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 4 Region: 489-537
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.4e-18
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 5 Region: 363-411
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.33e-17
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 6 Region: 434-485
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000428
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 7 Region: 207-239
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000597
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000381304-1
Sequence length 538
Comment ZFP90 (Homo_sapiens) zinc finger protein 90 homolog (mouse)
Sequence
METLKLLSKIVILKESVTFKDVAVDFTREEWHHMDSAQRSLYRDVILENYSHLVSLVYQV
SKPEVIFKLEQGEEPWISEGEIQRLFCSDWKTRPEAKSSKLQHSTSEVSPSTDDFSHVTL
KDVWDISSQLERHQENWRRYLEPEVSTQKKITTPEENFEQNKFGENSRLNIDLIPQLNIP
SRIRPSEYGTLGNNLGHNSDLLNQNNILAKKKPYKCNKCRKAFIHRSSLNKHEKTRKGED
TFSNGTGQGIYPGKKHHECTDCGQTFLWKTQLTEHQRIHTGEKPFECNVCGKAFKHSSSL
GQHENAHTGEKPYQCSLCGKAFQCSSSLVQHQRIHTEEKPYQCNLYGRSFRHGTSLTQHE
VTHSGEKPFQCKECGKAFSRCSSLGQHERTHTGEKSFECSTCGRAFGQSPSLYKHMRIYK
RGKPYQSNNYSIDFKHSSSLTQEESALSEVKSYHCNDCGEDFSHITDFTNHQRIHTGENP
YDCEQAFNQQSISHPGEKPYQCNVCGKAFKRSTRFIEHHRIHTGEKPYECNECGEAFS
Download sequence
Identical sequences G5B528
HGL_H00000381304-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]