SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000381304-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000381304-2
Domain Number 1 Region: 500-557
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.97e-24
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 2 Region: 257-314
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.35e-23
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 3 Region: 313-370
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.38e-22
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 4 Region: 8-66
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.62e-22
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 5 Region: 458-510
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.46e-20
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 6 Region: 219-271
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.15e-17
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 7 Region: 355-405
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000011
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 8 Region: 398-449
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000147
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 9 Region: 162-230
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000474
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000381304-2
Sequence length 578
Comment ZFP90 (Homo_sapiens) zinc finger protein 90 homolog (mouse)
Sequence
MLLSKIVILQESVTFKDVAVDFTREEWHHVDSAQRSLYRDVMLENYSHLVSLDWKTRPEA
KSSKLQHSTSEVSPSTDDFSHVTLEDAWDISSQLERQQKNWRRYLGPEVSTQKKITTPEE
NFEQNKFGENSRLNIDLIPQLNIPSRIRPSEYGTLGNNLGHNSDLLNQNNILAKKKPYKC
NKCRKAFIHRSSLNKHEKTHKGEDTFPNGTGQGIYPGKKHHECTDCGKTFLWKTQLTEHQ
RIHTGEKPFECNVCGKAFRHSSSLGQHENAHTGEKPYQCSLCGKAFQRSSSLVQHQRIHT
GEKPYRCNLCGRSFRHGTSLTQHEVTHSGEKPFQCKECGKAFSRCSSLVQHERTHTGEKP
FECSICGRAFGQSPSLYKHMRIHKRGKPYQSNNYSIDFKHSSSLTQEESTLSEVKSYHCN
DCGEDFSHITDFTNHQRIHTGENPYDCEQAFSQQSISHPGEKPYQCNVCGKAFKRSTSFI
EHHRIHTGEKPYECNECGEAFSRRSSLTQHERTHTGEKPYECNECGRAFRKKTNLHDHQR
IHTGEKPYSCKDCGKNFSRSSALTKHQRIHTRSKLQEP
Download sequence
Identical sequences G5C694
HGL_H00000381304-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]