SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000381571 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000381571
Domain Number 1 Region: 377-597
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.32e-53
Family DBL homology domain (DH-domain) 0.0000944
Further Details:      
 
Domain Number 2 Region: 902-1156
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000000000403
Family WD40-repeat 0.07
Further Details:      
 
Domain Number 3 Region: 611-685,779-831
Classification Level Classification E-value
Superfamily PH domain-like 0.0000141
Family Pleckstrin-homology domain (PH domain) 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000381571
Sequence length 1340
Comment ARHGEF10 (Homo_sapiens) Rho guanine nucleotide exchange factor (GEF) 10
Sequence
ENEVKYDTSNKEAEEGEQFDFDSGDEVPEADRQAPPQPGAWGAGGGAAQGPASASPEEGG
DKGPGAEAFEVAEPAKLLVPKVNPYSVIDITPLQEDALPPPDPATEEDGVGPHVPSGYLV
PVPCGYAVPSSLPMLLPAYSSPVIIRTESVDEEAEAPEVVGDHQSHSLSSEDPLLSGDQS
SREDSALARWAVDPANTAWMENPEEAIYDDVPRENSDSEPDGMLYDDVENGEQGGNSSVE
YGWSSSEFESYEEQSDSECRSGVPRPFLRSSHRKQVASSSHDLSRLKARCEESMRDLVAS
TVRAMGVQQLTCRQECKMQKLMKAAKEGTRDGLERTKAAVKRGRSFIRTKSFVSPDHRSC
LEEEQSLFIDVDCRHPEAVLTPMPEGLSQQQVVRRYILGSIVESEKNYVDALKRILEQYE
KPLSEMEPRVLSERKLKMVFYRVKEILQCHSMFQIALASRVAEWDAVETIGDVFVASFSK
SMVLDAYSEYVNNFGTAVAILKKTCATKPTFLEFLKQSQEASPDRVTLCSLMMKPIQRFP
QFILLLQDMLKNTPRGHPDRLPLQMALTELETLAEKLNERKRDADQRCEIKHIAKAINER
YLNKLLCSGSRRLIRSDDVIETVYNDKGEITKTKERRLLMLNDVLMCATVSFRPSQESHV
GASQRYLLKWSVPLGHVEVMEYSNGPGIGEHSRHPAVHPPESLAVSANAKPYKTYLGPGQ
LYHDLQNLLHDLNVVGQIAQLIGSLRGNYQNLNQSVAHDWTSGLQSLILKKEDEIRAADR
CRIQLQLPGKQDKSGRPTFFTAVFNTFTPAIKEAWTSNLQMAKLALEEDNHLGWFCVDDD
GSQTKRDTHPLLVGHMPVMVARQPEFKIECAAYNPEPYLNNESQRDSLSMARGFLWIGSC
SSQMGQIAIISFQNSSPKVIECFNVESRILCMVYVPVQEQHREPSAASDPEPLTTHTSDV
PTICLGTEEGSISVYKSSQGSKKVRLQHFFSPEKSTVVSLASSPRGLHAGLVNGSVASYA
KAADGSWNVEPQKVIDLGVLPVRSLLVMEDTLWAASGGQVFIIGTETHAVQSQLEAHQEE
GMVISHMAVAGVGLWVAFTTGSTLRLFHTETLKHLQDVNIAAPVHGMLPGHQRLSVTSLL
VCHGLLMVGTSLGLVVALPVPRLQGIPKVTGRGMVSYHAHSGPVKFIVLATASPKDKDKA
RDSPPPGPEPPDEEQKDEPSGDRATSCPGQGDLTTAIWLGDWPGPGLQKSDLSSSSGSLS
LSHGSNSLELRAEDSSMCDFLRDPAGPVRGRARPSRRAKASSALVVCGGQGHRRMHRKAR
APPPEELLSSVMVWQIPLLS
Download sequence
Identical sequences G5AYN1
HGL_H00000381571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]