SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000381740 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000381740
Domain Number 1 Region: 320-529
Classification Level Classification E-value
Superfamily ADP-ribosylation 4.83e-51
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.0000657
Further Details:      
 
Domain Number 2 Region: 180-318
Classification Level Classification E-value
Superfamily Domain of poly(ADP-ribose) polymerase 5.36e-40
Family Domain of poly(ADP-ribose) polymerase 0.00015
Further Details:      
 
Domain Number 3 Region: 41-152
Classification Level Classification E-value
Superfamily WGR domain-like 6.28e-35
Family WGR domain 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000381740
Sequence length 531
Comment PARP3 (Homo_sapiens) poly (ADP-ribose) polymerase family, member 3
Sequence
MAPKRKPSVKTEHSEKKRRQEPGEENSFHSTAEALRAAPVEKRIVCMDPNCPLSNNPGTQ
VHKDYDCTLNQSNIRCNNNKFYVIQLLEDGNNFFCWNRWGRVGEVGQSKMNHFTCLEDAK
KDFEKKFHDKTKNKWAERDHFVAHSGKYTLIEVQGEANAQEAMVQVDGGPAGTVVRQVRP
CSLDPATRKLITNIFSKEMFKNAMTLMNLDVKKMPLGKLSKQQIARGFEALEALEGALKP
PTDGSPSLEELSSHFYTIIPHNFGRSRPLPINSLELLQAKKDMLLVLADIELAQTLQAAS
GAEERVEEVPHPLDRDYQLLKCQLQLLDSGAPEYKVIQTYLEQTGSTYRCPALQHVWKVN
REGEGDRFQAYSKLRNRRLLWHGTNVAVVAAILTSGLRIMPHSGGRVGKGIYFASENSKS
ASYVTAMHCGNHQVCYMFLGEVALGKEYCITMDNPGLKSPPLGFDSVIARGHTEPDPTQD
IELELDGQRVMVPQGRPVPCSEFSSSHFCQSEYLIYQESQCRLRYLLELHL
Download sequence
Identical sequences G5AXN7
HGL_H00000381740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]