SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000381911 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000381911
Domain Number 1 Region: 155-344
Classification Level Classification E-value
Superfamily E set domains 8.4e-65
Family Cytoplasmic domain of inward rectifier potassium channel 0.0000197
Further Details:      
 
Domain Number 2 Region: 49-169
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.04e-18
Family Voltage-gated potassium channels 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000381911
Sequence length 375
Comment KCNJ15 (Homo_sapiens) potassium inwardly-rectifying channel, subfamily J, member 15
Sequence
MDTMHVSVTRPPLLQHTAGPGLKAHRPRVMSKSGHSNVRIDKVDGIYLLYLQDLWTTVID
MQWRYKLTLFAATFVMTWFLFGVIYYAIAFIHGDLEPSETISNHTPCIMKVDSLTGAFLF
SLESQTTIGYGVRSITEECPHAIFLLVAQLVITTLIEIFITGTFLAKIARPKKRAETIKF
SHCAVITKQNGKLCLVIQVANMRKSLLIQCQLSGKLLQTHVTKEGERILLNQATVKFHVD
SSSESPFLILPMTFYHVLDETSPLRDLTPQNLKEKDFELVVLLNATVESTSAVCQSRTSY
IPEEIYWGFEFVPVVSLSKNGKYVADFSQFEQIRKSPDGTFYCADSEKQKLEEKYRQEDQ
RERELRTLLLQQSNV
Download sequence
Identical sequences G5AXI3
HGL_H00000381911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]