SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000381970 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000381970
Domain Number 1 Region: 135-286
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.25e-17
Family Retroviral integrase, catalytic domain 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000381970
Sequence length 521
Comment GIN1 (Homo_sapiens) gypsy retrotransposon integrase 1
Sequence
MVRSGKNGDLHLKQIAYYKRTGEYHATTLPSERSGIRRAAKKFVFKEKQLFYVGKDRKQN
RLVIVSEEEKNKVLRECHENDAGAHHGISRTLTLVESNYYWTSVTNDVKQWVYACQHCQV
AKNTVILAPKQHLLKVENSWSIVTVDPMGPFHASNRSHVYAIILTDLFTKWVMILPLCDV
SASEISKAITNVFFLYGPPQKIIMDQRDEFIQQINVELYGLFGTKEIVISHAAGTVNPTE
STPRTIKAFLSKHCADHPENWDEHLSAVSFAFNATHLEPAKNTPYFQMFNRNPYIPKTSD
TLHEMDADNTSMFARILDAFKEAEKIMEAKTTSMGQMEKHLNRLHKSKIIVKKKPKQLNP
FHLKVGHEVLRQRKNRWKDGRFQSEWIGPCVIDYITESGCAVLRDNTGTRLKRPIKMSHL
KPYVRESSEQDSLYLLQGSIVADHDYIGLPEIPVGTHQANILVEDATVGVVDNELLTSSK
EHELLEYRNPKTSSLIEDHGTLEKQTFSLLDSSNQVLEYLS
Download sequence
Identical sequences G5B9C5
HGL_H00000381970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]