SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000381982 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000381982
Domain Number 1 Region: 1580-1711
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.49e-24
Family Synaptotagmin-like (S variant) 0.03
Further Details:      
 
Domain Number 2 Region: 214-344
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 8.4e-22
Family Synaptotagmin-like (S variant) 0.016
Further Details:      
 
Domain Number 3 Region: 368-480
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.3e-19
Family PLC-like (P variant) 0.09
Further Details:      
 
Domain Number 4 Region: 1804-1968
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.98e-18
Family Synaptotagmin-like (S variant) 0.012
Further Details:      
 
Domain Number 5 Region: 1210-1316
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000000156
Family Synaptotagmin-like (S variant) 0.043
Further Details:      
 
Domain Number 6 Region: 957-996,1086-1141
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000000286
Family Synaptotagmin-like (S variant) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000381982
Sequence length 2096
Comment FER1L6 (Homo_sapiens) fer-1-like 6 (C. elegans)
Sequence
MRAVRGPVMLHRNVASLQEARPGTFSTSPDKYRLLPTCWADLLGPEAAPVLTRLAEQPIL
EEDPGHQPCQASQLITGSLAVLHLAECPAGGQETGPRKGMFGLKLKKKKKNKAEKGLILA
NKAAQDGQSDTEALQEGPSHQEGSQGDLIHDDVSITPALSAPPERRSKLLTKIHDGEVKS
QSYQVGDQLFLPSPRPSSPRAAQSERLCHFLLQISITIIEARQLVGENIDPVVTIEIGDE
KKQSTVKEGTNSPFYNEYFVFDFIGPQVHLFDKIIKISVFHHKLLGNVLIGSFKVDLGTV
YNQPGHQFCDKWALLTDPGDIRTGAKGYLKCDIHVTGKGDTLQTNPKASDAEEQIEKNLL
IPQGFPSERPWARFYVRLYRAEGLPKMNSSIMANVTKAFVGDSKDLVDPFVEVSFAGQTG
RTTVQKNCADPIWHEQVIFKEMFPPLCRRVKIQVWDEGSMNDVALATHFIDLKTISNEQD
GDKGFLPTFGPAWINLYGSPRNHSLMDDYQDLNEGFGEGVSFRGRILVEIAVEILSGGAQ
ESKFSKAMKNLKLTSKDKDSKSSKGSSKDKAEKADDGKSQQASDRTNSTEVEVEPFEVAP
EIIPEKYEEFLLFGAFFEATMIDRKIGDKPISFEVSIGNFGNLIDGGSHHGSKKKSAESV
EEEDILPLLHEGAGDAAHEAPISMSPTTCPEKPLVTEGNRNYNYLPFEAKKPCVSFISSW
GDQTFRLHWSNMLEKMADLLVEGIEEVRELIKASEEAPEENMKAVLSDFISQSSAFISEA
EKKPKTLNQTTLDKKRLTLCWQELEAMSKDAKAMFQQQKKKFSLDEMIQEAQDFVGKIRF
LVDEPQHTIPDVFIWMLSNNKRVAYARVAAKDLLYSPIREQKGKHCGKIKTHFLKLPGKR
LAGWSVQAKVDVYLWLGSTRFSGTMLGNLPEGYEAEMPSKAAGAHHPPSNLLYQAQHVFQ
LRAHMYQARGLIAADSNGLSDPFARVTFLSQCQTTKGGFSEVLCSGDSGCSLTSCMAGEH
LNSPALRSNFSSAWLALAKRGAAPGVYRAVPGVKWGLEETGRVRCSRGRHKHPVRVTAVI
AAPLKVISQTLSPTWNQMLLFNEVVLHGDERELAEAPPLVVVELYDSDAVGKPEYLGATV
AAPIVTLADQDYEPPQLCYHPVFCGTLSGGDLLAVFELLQVPAAGLQALPPIDTPDVTQI
YPVPANIRPVLSKYRVEVLFWGVREMKKVQLLSVDRPQVLIECGGRGVKSCVIQSYKNNP
NFSVQADTFEVELPENELLHPPLSICVVDWRAFGRSTLVGTYTINCLKQFLCKPREPPAL
TSQMDVAQAKPAISDSLMASASSELPSSSQDPPTDHVYVDVEPPTTVVPDSAQVQPAILV
DIPDSSPMLEPEHKPAAQETPKDGKVKDVRKPSRRSTKRRKRTIADESAENVIDWWSKYY
ASLQKAQKEKESDPKEKKGHPESQPDEVVLEIEDGPKKKKDKILKKKPKDGGDDRIPNLA
VLKIYDGDLESEFNNFEDWVKTFKLFRGKSTEDDHGLDGDRSIGKFKARSHVNLWLTLTL
SGSFCIYKSPEESSSEDKGQLRIQQGIPPNHPVQVLIRVYIVAAFNLSPADPDGKSDPYI
VLRLGKTEIKDRDKYIPKQLNPVFGRSFEIQATFPKESLLSILIYDHDMIGTDDLIGETK
IDLENRFYSKHRAICGLQSQYEVEGYNAWRDTSKPTEVLTKLCRENGLDVPYFSPGKIQI
GSKVFSGKTVFTEEDSDEAVESYEHLALKVLHSWEDVPEVGWRLVPEHIETRPLYHKDKP
GMEQGRLQMWVDMFPKDMPQPGPPVDISPRKPKGYELRVTIWNTEDVILEDENIFTGQKS
SDIYVKGWLKGLEDDKQETDVHYNSLTGEGNFNWRFLFPFQYLPAEKQMVITKRENIFSL
EKTECKTPAVLVLQVWDFERLSSDDFLGSLEMNLNSFPRAAKSAKACDLSKFENASEENK
ISIFQQKRVRGWWPFAKSKELTGKVEAEFHLVTAEEAQKSPVGKARKEPEPLAKPNRPDT
SFSWFMNPFKCLYHLIWRNFKKYIIIGFILIILIIFLVLFIYTLPGAISRRIVVGS
Download sequence
Identical sequences G5AY92
HGL_H00000381982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]