SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000382015 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000382015
Domain Number 1 Region: 46-137
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.42e-39
Family SCAN domain 0.0000575
Further Details:      
 
Domain Number 2 Region: 287-344
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.45e-25
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 3 Region: 249-301
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-18
Family Classic zinc finger, C2H2 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000382015
Sequence length 368
Comment ZNF24 (Homo_sapiens) zinc finger protein 24
Sequence
MSTQSVEEDSILIIPTPDEEEKILRVKLEEDPDGEEGSSITWNHLPDPEVFRQRFRQFGY
QDSPGPREAVSQLRELCRLWLRPETHTKEQILELVVLEQFVAILPKELQTWVREHHPENG
EEAVTVLEDLESELDDPGQPVSLPRRKREVLVEEIVSQEEAQGLPSSELDAVENQLKWAS
WELHSLRHCDDDARTENGALAPKQEIASAVESHEVPGTLNIGVPQIFKYGETCFPKGRFE
RKRNPSRKKQHICDECGKHFSQGSALILHQRIHSGEKPYGCVECGKAFSRSSILVQHQRV
HTGEKPYKCLECGKAFSQNSGLINHQRIHTGEKPYECIQCGKSYSQSSNLFRHQRRHNAE
KLLNVVKV
Download sequence
Identical sequences G5C294
XP_004855268.1.39548 XP_012931453.1.39548 XP_012931454.1.39548 HGL_H00000382015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]