SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000382239 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000382239
Domain Number 1 Region: 402-488,880-956
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 9.51e-19
Family Canonical RBD 0.00027
Further Details:      
 
Domain Number 2 Region: 272-367
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 9.09e-17
Family Canonical RBD 0.0022
Further Details:      
 
Domain Number 3 Region: 144-235
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000000282
Family Canonical RBD 0.0016
Further Details:      
 
Domain Number 4 Region: 4-87
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000271
Family Canonical RBD 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000382239
Sequence length 959
Comment RBM12B (Homo_sapiens) RNA binding motif protein 12B
Sequence
MAVVIRLLGLPFIAGPVDIRHFFTGLTIPDGGVHIIGGDIGEAFIIFATDEDARRAISRS
GGFIKDSSVELFLSSKAEMQKTIEMKRIDRIGRGRPGSGASGVGSLSNYIEAMKEDENNS
GYGSSVNQDAGFHTNGTGLDDLRPRKTRPSKAENPYLFLRGLPYLVNEDDVRVFFSGLCV
DGVIFLKHHDGRNNGDAIVKFASCIDASGGLKCHRSFMGSRFIEVMQGSEQQWIECGGDA
VKKGEIPMRAEEHSPPRGLNDRHFRKRTHSKSPRRTRSRSPVGFYVHLKNLSLNVSKRDL
RNFFRDIDLTNEQIRFLYKDEKRTRYAFVTFKTLKDYNTALGFHKTVLQHRPIHIDPVSK
KQMLKFIECYEKKRPGGSIDKERSGHVSQKYSQEGYSGQKLCIYIRNFPFDVTKVEVQKF
FADFSLAEDDIYLLYDDKGVGLGEALVKFKSEEQAMKAERLNRRRFLGTEVLLRLISEAQ
IQEFGVNFPLMSTEKMQARSQSRDRDDHSHLFDSKDLSVYSVGPSENLRYELEDLRQQDN
FKHPQGYFRQPDRRPPEDFRHSPEDFRFSPEDFRRSPEIFRHPREKHFRRPPEEDFRRPR
EDDWRRPLEDWRWPLEEDFRQPPEEDFRRSLEGDFRRPPEEDFRRPWKEDFRCPPDDDFR
HPREEDFRKPTQEDFRHSPEDDFRRSPMEHIRRLPQDHFRRPPSEHLRRPPPEHFRQPPP
EHFRRPPQEHFRRPPQEHFRRPPQEHFRRSREDDFRHMPDEDFRGPPDEDFRGPPDEDFR
HLPDEDFRSPQEEDFRCPSDEDFRQLPEEDLREVPEEDPRLPDFRPGEDSRNPPEDFRSH
RPFVNFGRPEGGKFDFGKRNMGGFPEGRFMPDPKLNCSSGRVTPVKIMNLPFKANVNEIL
DFFHGYRIIPDSVSIQYNEQGLPTGEAIVAMINYNEAMAAIKDLNDRPVGPRKVKLILL
Download sequence
Identical sequences G5C4D1
XP_012929588.1.39548 XP_012929589.1.39548 XP_012929590.1.39548 XP_012929591.1.39548 XP_012929592.1.39548 HGL_H00000382239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]