SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000382296 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000382296
Domain Number 1 Region: 9-85
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.71e-17
Family Canonical RBD 0.0000525
Further Details:      
 
Weak hits

Sequence:  HGL_H00000382296
Domain Number - Region: 169-217
Classification Level Classification E-value
Superfamily Tropomyosin 0.0634
Family Tropomyosin 0.0041
Further Details:      
 
Domain Number - Region: 221-254
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0772
Family TSP type-3 repeat 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000382296
Sequence length 276
Comment RALYL (Homo_sapiens) RALY RNA binding protein-like
Sequence
MTGKTQTSNVTNKNDPKSINSRVFIGNLNTAIVKKVDIEAIFSKYGKIVGCSVHKGYAFV
QYMSERHARAAVAGENSRIIAGQPLDNLRSTDHGYVFDYDYYRDDFYNRLFDYHGRVPPP
PRAVIPLKRPRMAVTTTRRGKGVFSMKGGSRSASGSSSSGSKLKSDELQTIKKELTQIKT
KIDSLLGRLEKIEKQQKAEAEAQKKQLEESIELIQDECVSENADHSTEEPAEGGQDADGE
EMTDGIEEDFDEDGGHELVGTKYLMSTIHHLTALAC
Download sequence
Identical sequences HGL_H00000382296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]