SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000382428 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000382428
Domain Number 1 Region: 529-718
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.04e-55
Family Nucleotide and nucleoside kinases 0.00000000796
Further Details:      
 
Domain Number 2 Region: 401-557
Classification Level Classification E-value
Superfamily SH3-domain 1.71e-32
Family SH3-domain 0.00000393
Further Details:      
 
Domain Number 3 Region: 300-397
Classification Level Classification E-value
Superfamily PDZ domain-like 2.5e-32
Family PDZ domain 0.000017
Further Details:      
 
Domain Number 4 Region: 47-150
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-28
Family PDZ domain 0.0000223
Further Details:      
 
Domain Number 5 Region: 153-248
Classification Level Classification E-value
Superfamily PDZ domain-like 5.39e-26
Family PDZ domain 0.0000183
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000382428
Sequence length 721
Comment DLG4 (Homo_sapiens) discs, large homolog 4 (Drosophila)
Sequence
MDCLCIVTTKKYRYQDEDTPPLEHSPAHLPNQANSPPVIVNTDTLEAPGYVNGTEGEMEY
EEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFVNEV
DVREVTHSAAVEALKEAGSIVRLYVMRRKPPAEKVMEIKLIKGPKGLGFSIAGGVGNQHI
PGDNSIYVTKIIEGGAAHKDGRLQIGDKILAVNSVGLEDVMHEDAVAALKNTYDVVYLKV
AKPSNAYLSDSYAPPDITTSYSQHLDNEISHSSYLGTDYPTAMTPTSPRRYSPVAKDLLG
EEDIPREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQILSVN
GVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEAKIHDLREQLMNSSLGSGTASL
RSNPKRGFYIRALFDYDKTKDCGFLSQALSFRFGDVLHVIDASDEEWWQARRVHSDSETD
DIGFIPSKRRVERREWSRLKAKDWGSSSGSQGREDSVLSYETVTQMEVHYARPIIILGPT
KDRANDDLLSEFPDKFGSCVPHTTRPKREYEIDGRDYHFVSSREKMEKDIQAHKFIEAGQ
YNSHLYGTSVQSVREVAEQGKHCILDVSANAVRRLQAAHLHPIAIFIRPRSLENVLEINK
RITEEQARKAFDRATKLEQEFTECFSAIVEGDSFEEIYHKVKRVIEDLSGPYIWVPARER
L
Download sequence
Identical sequences A0A1U7TMR9 A0A2J8RX94 A0A2K5ZWC6 F6Z461 G5B5A1 H9FQS7 K7DBF4
HGL_H00000382428 ENSP00000307471 gi|192447426|ref|NP_001122299.1| NP_001122299.1.87134 NP_001122299.1.92137 XP_003791217.1.62490 XP_003810152.1.60992 XP_003929183.1.74449 XP_004638435.1.9945 XP_004857430.1.39548 XP_005332819.1.77405 XP_005349776.1.66349 XP_005399608.1.28644 XP_005582766.1.63531 XP_006973462.1.50099 XP_008008281.1.81039 XP_008059115.1.4292 XP_010613101.1.5607 XP_011725202.1.29376 XP_011850016.1.47321 XP_011908948.1.92194 XP_012312858.1.9421 XP_012632441.1.48125 XP_014973918.1.72884 XP_015359872.1.40921 XP_016786894.1.37143 XP_017387166.1.71028 XP_020007039.1.5219 XP_021503785.1.76796 ENSCJAP00000028596 ENSP00000307471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]