SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000382434 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000382434
Domain Number 1 Region: 348-879
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 9.42e-151
Family Lysophospholipase 0.000000228
Further Details:      
 
Domain Number 2 Region: 89-209
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.15e-23
Family PLC-like (P variant) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000382434
Sequence length 887
Comment PLA2G4E (Homo_sapiens) phospholipase A2, group IVE
Sequence
MGFLLATHYLRGSVPVSLGRARQGCPQMTVIMECSSRDTDDKSTAIRRTAKSGGYLGALE
ESWVKQKAAGKQALRNEDEGRDKEREGQSPCHLLTVRVIQMKNVRQADLLSQTDCFVSLW
LPTASSEKVRTRTISNCPNPEWNETFSFQIQTQVKNVLELSVCDEDPITPNDHLLIVLYD
LSKLCFRKKVHVKFPLNPEGLEELEVEFLLAESPSPAETLITNGVLVSRQVSCLEVHAES
RRQRKRKKMKDLLVTVTESFENTQRISPRREPCCPDPSSFHYPKYFQPCLQVAVPKSHWD
CLLSCCSTHKSSPVCQPLDCLSDSQAVTLPVNENYELHMKSTPCPDTLDVRLGFNLCPEE
LKFLEKRKVVVAEALKQVLQLEEDLAEDEVPLIAIMATGGGARSMTSLYGHLLGLQKLNL
LNCSSYISGLSGATWTMATLYQDPEWSSKDLQSAIFEARRHAVKDKMPSLFPDQLLKFKE
ELRQRTQEGYKVTFTDFWGLLLESCLGDESSEYKLSDQRAAVCQGQNPLPIYLTINVKDD
VSNQDFREWCEFSPYEVGMQKYGAFIPPELFGSEFFMGRLMKRIPESRMCYMLGLWSSIF
SLNLLDAWNLCNTSEEFLHRWTREKVHDIEDEPLLPEIPKCDANILETSVVNPASWLSNT
FREVLTYRSFGSEFHNFMYGLQLHTGYLRNSHFQKWKDTVLDRFPNQLTEFAKHLCLLDT
AFFVNSSYAPLLRQERKADLVIHLNYSAGSQTKPMKQTCEYCTEQGIPFPSYGIEDDDQN
LQECYLMEQPQDPDVPVVAFFPLINDTFQKYKAPGVERSPEEMELGQVNIYGPKSPYATK
ELTYTEAAFDKLVKLSEYNILNNKDKLLQALRLAVEKKKRLRSPCPS
Download sequence
Identical sequences G5BM22
HGL_H00000382434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]