SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000382659 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000382659
Domain Number 1 Region: 165-350
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.99e-18
Family Ankyrin repeat 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000382659
Sequence length 851
Comment TRPV1 (Homo_sapiens) transient receptor potential cation channel, subfamily V, member 1
Sequence
MKKWASIDSRESEHPPQEEDSSLDPPDTDANSKTPPAKPHIFSVSKSRTRLFGKGDSEEL
SPMDCSYEEGEPVSCPTITVSSVVISPRPGDGPTCARQLSQDSIPASAEKPLKLYDRRSI
FDAVAQNNCQELDSLLPFLKKSKKRLTDTEFKDPETGKTCLLKAMLNLHNGQNDTISLLL
DIAQETDSLREFVNASYTDSYYKGQTALHIAIERRNMALVTLLVENGADVQAAANGDFFK
KTKGRPGFYFGELPLSLAACTNQLAIVKFLLQNSWQPADISARDSVGNTVLHALVEVADN
TADNTKFVTSMYNDILILGAKLYPTLKLEEITNKKGFTPLALAASSGKIGVGEEPSLAPL
QVLAYILQREIPEPECRHLSRKFTEWAYGPVHSSLYDLSCIDTCEKNSVLEVIAYSSSET
PNRHDMLLVEPLNRLLQDKWDRFVKRIFYFNFFIYCLYMIIFTTAAYYRPVDGLPPYKLK
NTVEDYFRVTGEILSVTGGVYFFFRGIQYFLQRRPTMKTLFVDSYSEILFFVQSLFMLVS
VVLYFSHRKEYVASMVFSLALGWTNMLYYTRGFQQMGIYAVMIEKMILRDLCRFMFVYLV
FLFGFSTAVVTLIEDGKNDSLPIESHRWRGPSCRTSSNSYNSLYSTCLELFKFTIGMGDL
EFTENYDFKAVFIILLLAYVILTYILLLNMLIALMGETVNKIAQESKNIWKLQRAITILD
TEKSFLKCMRKAFRSGKLLQVGYTPDGKDDYRWCFRVDEVNWTTWNTNVGIINEDPGNCE
GVKRTLSFSLRSGRVSGRNWKNFALVPLLRDASTRDRHSSHPDEVHLKHFSGSLKPEDAE
VFKDSVAPGEK
Download sequence
Identical sequences G5B938
HGL_H00000382659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]