SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000382697 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000382697
Domain Number 1 Region: 73-413
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.24e-87
Family Protein kinases, catalytic subunit 0.00000221
Further Details:      
 
Domain Number 2 Region: 947-1013
Classification Level Classification E-value
Superfamily G protein-binding domain 9.94e-23
Family RhoA-binding domain 0.000037
Further Details:      
 
Domain Number 3 Region: 1117-1207,1289-1320
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000752
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Domain Number 4 Region: 1226-1275
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000112
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.012
Further Details:      
 
Domain Number 5 Region: 426-528
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000654
Family Myosin rod fragments 0.0026
Further Details:      
 
Weak hits

Sequence:  HGL_H00000382697
Domain Number - Region: 568-802
Classification Level Classification E-value
Superfamily Tropomyosin 0.00157
Family Tropomyosin 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000382697
Sequence length 1353
Comment ROCK1 (Homo_sapiens) Rho-associated, coiled-coil containing protein kinase 1
Sequence
MSTGDSFETRFEKIDNLLRDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDNFLSRYK
DTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAF
FWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTA
EVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDY
ISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFP
DDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLS
SDIDTSNFDDLEEDKGDEETFPIPKAFVGNQLPFVGFTYYSNRRHLSAANPNDNRTSSNV
DKSLQESLQKTIYKLEEQLHNEMQLKDEMEQKCRTSNIKLDKIMKELDEEGNQRRNLEST
VSQIEKDKMLLQHRISEYQRKAEQENEKRRNVENEVSTLKDQLEDLKKVSQNSQLANEKL
AQLQKQLEEANDLLRTESDTAVRLRKSHTEMSKSISQLESLNRELQERNRILENSKSQTD
KDYYQLQAVLEAERRDRGHDSEMIGELQARITSLQEEVKHLKHNLERVEEERKEAQDMLN
HSEKEKNNLEIDLNYKLKSLQQRLEQEVNEHKVTKARLTDKHQSIEEAKSVAMCEMEKKL
KEERKAREKAENRVVQIEKQCSMVDVDLKQAQQKLEHLTENKERMEDEVKNLTLQLEQES
NKRLLLQNELKTQAFEADNLKGLEKQMKQEINTVLEAKRLLEFELAQLTKQYRGNEGQMR
ELQDQLEAEQYFSTLYKTQVKELKEELEEKNREYLKKIQELQNEREALSTQLDLAETKAE
SEQLARGLLEEQYFELTQESKKAASRNRQEITDKDHTVSRLEETNNMLTKDIELLRKENE
ELTDKMKKAEEEYKLKKEEEISNLKAAFEKNINTERTLKTQAVNKLAEIMNRKDFKIDRK
KANTQDLRKKEKENRKLQLELNQEREKFNQMVVKHQKELNEMQAQLVEECTHRNELQMQL
ASKESDIEQLRAKLLDLSDSTSVASFPSADETDGNLPESRIEGWLSVPNRGNIKRYGWKK
QYVVVSSKKILFYNDEQDKEQSNPSMVLDIDKLFHVRPVTQGDVYRAETEEIPKIFQILY
ANEGECRKDVEMEPVQQAEKTNFQNHKGHEFIPTLYHFPANCEACAKPLWHVFKPPPALE
CRRCHVKCHRDHLDKKEDLISPCKVSYDVTSARDMLLLACSQDEQKKWVTHLVKKIPKNP
PSSFVRASPRTLSTRSTANQSFRKVVKNTSGKT
Download sequence
Identical sequences G5BTS2
HGL_H00000382697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]