SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000382842 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_H00000382842
Domain Number - Region: 2-150
Classification Level Classification E-value
Superfamily Tropomyosin 0.0477
Family Tropomyosin 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000382842
Sequence length 287
Comment TMCO5B (Homo_sapiens) transmembrane and coiled-coil domains 5B
Sequence
NLEATKQNLNRLNSDLEKDLQTLDEANEALLRKIQEKEKTVQSLERDLTLPAETDKEEEE
LNQIILEKNDALKNLEVEIAKLEEKNTILSKNVEELQEKISRGLKNFGPTKETLRKNLAE
LKVKLQQSVELCELQEKEIAKVQSDYQLIHELCEEQSHCIRMYLELLRQLEKEKELLILN
KEIAKAQNSSQAAKPGSILVETIQKNMEKTIMKKEKRFSFFRLFLWLFFMALIFIELLGC
LFFHLQYINPDLIVDTLPMLMSRRNQKRLRDFLSPLLTLESDTLLPH
Download sequence
Identical sequences G5BGS1
HGL_H00000382842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]