SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000382895 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000382895
Domain Number 1 Region: 535-672
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.03e-42
Family PLC-like (P variant) 0.0000364
Further Details:      
 
Domain Number 2 Region: 708-843
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.03e-35
Family PLC-like (P variant) 0.026
Further Details:      
 
Weak hits

Sequence:  HGL_H00000382895
Domain Number - Region: 1069-1218
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00573
Family PLC-like (P variant) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000382895
Sequence length 1236
Comment RPGRIP1 (Homo_sapiens) retinitis pigmentosa GTPase regulator interacting protein 1
Sequence
MSREELEDSLFRLREEHMSVKGLFWKQQEEIKRLRTALIRLRLTAVGGDRRVQAAAAAQK
SQKSEPASRPSHAAGRQRLPVHQRSLRHRSPAPLLRVRALAPDRAQLRGRLGHRQLHTAG
AREPEKPARAPRVRPSYTAPPTFKEHVTKEKPRSETTCEASKPTHIMSNNTMQVEEPPSS
PEKMWSQDENFEQKSSLECTQKAAELRASIKENVELIRLKKLLHERETSLAATKAQLTEV
QENQGILSVAHNALFSQMDELRAEFKEECKKTVSLRSQLEDASVLKTTLKEFQERVEDLE
KEQKLLTDSYNRLLEDMLDSRKQPPWSSNLAGDQLWQQLSQLQDQLDAELEEKRKILLQL
STEKAQNEDLKLEVTNIVQKHKQEIEMFQKAATTAQSPRLSELAPLQAPFLETAQIEPSE
PKVQEEKKLSQMLSELRVSHAETTLELEKTRDMLLLQHQINMCYQEELEAMMTKADSESK
DHREKLERLSQLLDLKNNRIKQLEEQLKDVAYGTQPLSLCLETLPAHGDEDGVDISLLHQ
SENLFELHIHQAFLTSAALVQAGDTQPTTFCTYAFYDFETHCTPLSVGPQPLYDFTSQYV
VETSSLFLHYLQGASAQLDLHQAVASEHQTLAAAWICFDKVLETVEKVHGSAMLTGAGGE
DFGVLEYWVRLRLPLRVSLQACRKQKKAQAYLSASVHGAREAQKDESRSDTRNPQNELRI
EITRCCGLRSRRLGTQPSPYAVYRFFTFSDHDTTIIPASDNPYFKDQAQFPVLESSELDQ
YLRQEALSIYVFDDEDSEPGSYLGRVQVPLLPLAQNNPIKGDFNLIDPAEKPNGSIQLKL
DWKSHYLPPESFLKPEAHTKVNDTKENLMGSVFKIGVNEIHSANVICNANLTWKLLMEQN
PEFYCGEEREHPSVLWQNWLSSAEVPTEADQYQAKRKLPQVGARKEKEHQVVSYSRRKHG
QRLGVQGRNRLECFSRNILSGDTIQVNYMDWKFSGLKISKDDGFTTQLEEEEMTLSHSAL
KQEETPHPINDPESSEQTSEASETQATDRDDVVVAPLSEKYPKPDSEKMSIEIVSLAFYP
EAEVMSDEKVKQVYVEYRFYDLPLSETETPVSLRKPRAGEEIHFHFSKVIDLDPLEQQGR
RQFLFDMLQAQNPEQRHLKFTVVSDPMDEEAKDCEEVGYVYLELWQILESGRDIIEQELE
IVSPEDQDVAIGRLKVSLKAAAALHSIYQEMIEDLL
Download sequence
Identical sequences G5BFV4
HGL_H00000382895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]