SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000382987 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000382987
Domain Number 1 Region: 2-51
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.27e-20
Family KRAB domain (Kruppel-associated box) 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000382987
Sequence length 91
Comment ZNF705B (Homo_sapiens) zinc finger protein 705B
Sequence
EAMTFEDVAVDFTMEEWALLDPSQKKLHRDVMWENFTNVTAIGRNWENQQQIEDEYQNFR
KTLSCHPCVQIQDSPFLSMWAMLGAVSCEAL
Download sequence
Identical sequences G5BNR5
HGL_H00000382987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]