SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000383028 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000383028
Domain Number 1 Region: 1207-1369,1397-1476
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.33e-40
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 2 Region: 635-660,696-905
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.02e-33
Family Voltage-gated potassium channels 0.015
Further Details:      
 
Domain Number 3 Region: 1524-1770
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.1e-33
Family Voltage-gated potassium channels 0.019
Further Details:      
 
Domain Number 4 Region: 142-266,368-435
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.43e-30
Family Voltage-gated potassium channels 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000383028
Sequence length 2156
Comment CACNA1I (Homo_sapiens) calcium channel, voltage-dependent, T type, alpha 1I subunit
Sequence
MRATLDDAFQRIPVFTKTETFKESNADLAKPAASCLVLGAPGLSRLQVPQGFLCGADMAE
STSPPSSSAAAAPALEPGITEQPGPQSPPPSPPGLEEPLDGADPDVPHPDLAPVAFFCLR
QTTSPRNWCIKMPCDDMDCLSDRCKILQVFDDFIFIFFAMEMVLKMVALGIFGKKCYLGD
TWNRLDFFIVMAGMVEYSLDLQNINLSAIRTVRVLRPLKAINRVPSMRILVNLLLDTLPM
LGNVLLLCFFVFFIFGIIGVQLWAGLLRNRCFLEENFTIQGDMALPPYYQPEEDDEIPFI
CSLSGDNGIMGCHEIPPLKEQGRECCLSKDDVYDFGAGRQDLNASGLCVNWNRYYNVCRT
GSANPHKGAINFDNIGYAWIVIFQVITLEGWVEIMYYVMDAHSFYNFIYFILLIIVGSFF
MINLCLVVIATQFSETKQREHRLMLEQRQRYLSSSTVASYAEPGDCYEEIFQYVCHILRK
ARRRALGLYQVLQSRHQALGLGAPAPAKPGPHAKEPRHCKLCLRHSPLDPTPHTLVQPIS
AMLASDPISCPRCQHGTGQQPSGPGSTDSGQEGSGSGGSGGDEVEADGDGPRSSEDGGSS
GPGKEDEEEQPDGAAGLCGDVWRETRGKLRGIVDSKYFNRGIMMAILVNTVSMGIEHHEQ
ASVVGLQLGSSRSTGSIQFTQIRPPGLPLTLWLELLPEELTNILEICNVVFTSMFALEMI
LKLAAFGLFDYLRNPYNIFDSIIVIISIWEIVGQADGGLSVLRTFRLLRVLKLVRFMPAL
RRQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHIFGCKFSLRTDTGDTVPDRKNFDSLL
WAIVTVFQASGSSVSILTQEDWNVVLYNGMASTSPWASLYFVALMTFGNYVLFNLLVAIL
VEGFQAEGDANRSYSDEDQSSSNMEELDKLQEGLDSSGDLKLCPIPMTPNGHLDPSLPLG
GHLGPSGAADPAARLSLQPDPMLVALDSRKSSVMSLGRMSYDQRSLSSSRSSYCGPWGRS
GAWASRRSSWNSLKHKPPSAEHESLLSAERSGARVSEGARDEGPPRAAPLHAPHVHHAHH
GPHVAHRHRHHRRTLSLDTRDSVDLAELVPTVGGHPRAAWRAAGSGPGHENCNGRMPSIA
KDVFTKMDDRRDRGDDEEEIDYTLCFRVRKMIDVYKPDWCEIREDWSVYLFSPENRFRVL
CQTVIAHKLFDYVVLAFIFLNCITIALERPQIEAGSTERIFLTVSNYIFTAIFVGEMTLK
VVSLGLYFGEQAYLRSSWNVLDGFLVFVSIIDIVVSVASAGGAKILGVLRVLRLLRTLRP
LRVISRAPGLKLVVETLISSLKPIGNIVLICCAFFIIFGILGVQLFKGKFYHCLGVDTRN
ITNRSDCVAANYRWVHHKYNFDNLGQALMSLFVLASKDGWVNIMYNGLDAVAVDQQPVTN
HNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQHQEAEEARRREEKRLRRLEKKRR
KAQRLPYYATYCPTRLLIHSMCTSHYLDIFITFIICLNVVTMSLEHYNQPTSLETALKYC
NYMFTTVFVLEAVLKLVAFGLRRFFKDRWNQLDLAIVLLSVMGITLEEIEINAALPINPT
IIRIMRVLRIARVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFG
KLACNEENPCEGLSRHATFENFGMAFLTLFQVSTGDNWNGIMKDTLRDCTHDERSCLSSL
QFVSPLYFVSFVLTAQFVLINVVVAVLMKHLDDSNKEAQEDAEMDAEIELEMAHGLGPSP
QPPAASPGAPGRGPGVAGSGGDSEGHRCRRCYSPAQETLWLDSVSLIIKDSLEGELTIID
NLSGSIFHHYASPTPAGCRKCHHDKQEVQLAETEAFSLNSDRSSSILLGDDLSLEDPTAC
PSGPKDSKGEPDVSEPMRVGDLGECFFPLPNAAVSSGTENFLCEMEAIPFNPVRSWLKHE
SSQAPPSPFSPDSSSPLLPMPAEFFHPAVSTSQKGQEGGAGVGTLPKIALQGSWASLRSP
SVNCTLLRQATVSDTSLDASPSSSAGSLQTTLEDSLTLSDSPRCVLGPPAPVPGPRAGLS
PATRAVSIELYICVLYSLQFFKNYTTTQPRGLARRPSWASDRSKDPTGQATLSSGP
Download sequence
Identical sequences G5AYV8
HGL_H00000383028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]