SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000383301 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000383301
Domain Number 1 Region: 27-88
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.58e-26
Family KRAB domain (Kruppel-associated box) 0.00089
Further Details:      
 
Domain Number 2 Region: 335-392
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.69e-25
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 3 Region: 419-476
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.79e-24
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 4 Region: 279-336
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.04e-24
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 5 Region: 475-532
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.03e-23
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 6 Region: 517-569
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.23e-17
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 7 Region: 242-293
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.59e-16
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 8 Region: 382-413
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000236
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000383301
Sequence length 638
Comment ZNF74 (Homo_sapiens) zinc finger protein 74
Sequence
ALFTQDLTLFPKENPENKSDWGLLEARSEESVTFKDVAVDFTQEEWGQLDSPQRALYRDV
MLENYQNLVALGPPVCKPDVISHLERGEEPWRVYREGSGGACSEWGPAPEMKEEFCKEEP
SQEAVMGELNRHSFHRPSLSTAWEASTVVWRTQAEQWEQVHATLRDISTEQRYRGHNNSK
EGSPLKCSLFTQQSAPLGGHSPARRTLDIQSTGAVTRDQQRTCPGERSLKSRPCGAGPGA
DAFVCAECGKTFPQSTSLALHRRWHGRTKSYKCGECDKAFTWSTNLIEHQRIHTGEKPFF
CSECGKAFSCHSSLNVHQRIHTGERPYKCSACEKAFSCSSLLNMHLRVHTGEKPYKCGEC
GKAFNQRTHLTRHQRIHTGEKPYKCGTCGKAFTCHSSLTVHEKIHNGDKPFKCTECEKAF
NNRSRLTLHQRIHTGEKPFKCTDCGKGFSCHSYLIVHQRIHSGEKPFKCNECGKAFSSHS
YLIVHQRIHTGEKPFDCSKCWKAFSCHSSLIVHQRIHTGEKPYKCHECGKAFSQNHCLIK
HQKVHSGEKSFKCNKCGEMFSWSSHLLEHQRLLHGEEKPIAIQFNRHLLSTYYMPGSLLG
VEDSGVGDVDPINALDVAKLLCVVQPPPSRNFSLGRKP
Download sequence
Identical sequences G5C047
HGL_H00000383301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]