SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000383643-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000383643-1
Domain Number 1 Region: 487-543
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.89e-22
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 2 Region: 430-487
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.52e-22
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 3 Region: 1-57
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.72e-22
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 4 Region: 528-580
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.36e-19
Family Classic zinc finger, C2H2 0.0027
Further Details:      
 
Domain Number 5 Region: 304-356
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.79e-17
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 6 Region: 395-444
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.53e-17
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 7 Region: 342-397
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.8e-16
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 8 Region: 266-315
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000124
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Weak hits

Sequence:  HGL_H00000383643-1
Domain Number - Region: 154-201
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00734
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000383643-1
Sequence length 608
Comment MIR4273 (Homo_sapiens) microRNA 4273
Sequence
SVSFEDVVVSFTREEWQVLDDAQRTLYRDVMLETYCSLLLLGHCITKPEVIFKLEQGAEP
WMGEEPLNQSPSDVQKVGNVIEPSYKSQGWHLWQVVLTTNNTSAEERVELGFELKVLESN
FDFSSSQSLDLVTTNGDSSAMVDLPSESGEMDAGEKPNQCHLTGKTLRCPEHFSQHPKMP
TGQQDFQYSGQWKAFTREAKLLKECITHKRVPMGQACWEHNESGKACEKSALIATVGRKT
LHENCDLTTHQTHTGEKSCECEKTFLIQQKKHSEKEPYSSDRCENSSSYKSGIPMQQNFP
IGEKPYKCDECGEAFSTKSDLMRHEGIHAWGKLYECKECGKTFCRKSSLTIHQKIHSADK
PYQCTKCTIAFRKKSQLRRHWGRIHTEEKPKGCNECNECGKLFHRKSHLIKHQRTHTGEK
PYECVHCGKSFGQKIHLTKHQRTHTGEKPYKCSQCGKSFGQKIHLTKHESIHTMEKPYKC
NQCGKFFGQKTYLTKHQMIHTGEKPYGCDQCGKSFGQKTYLTNHQMTHTMEKPYKCNDCG
KSFAYKSYLAKHQMTHTGEKPYGCSQCGKAFRQTSHLSKHERTQHGRKASVNAETCLNHT
SANISKFT
Download sequence
Identical sequences G5ASR6
HGL_H00000383643-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]