SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000384264 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000384264
Domain Number 1 Region: 387-580
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.01e-48
Family cAMP-binding domain 0.0001
Further Details:      
 
Domain Number 2 Region: 140-385
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.22e-38
Family Voltage-gated potassium channels 0.0059
Further Details:      
 
Weak hits

Sequence:  HGL_H00000384264
Domain Number - Region: 599-645
Classification Level Classification E-value
Superfamily Tropomyosin 0.0752
Family Tropomyosin 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000384264
Sequence length 678
Comment CNGA1 (Homo_sapiens) cyclic nucleotide gated channel alpha 1
Sequence
MKTSIINTRWSFINIPNVVTPDVEKEIRRMENGACSSFSDNDSSASLSEESENENSHARG
SFRNNSCGREEPSQREQYLPGALALFNINNSSNKDHKPGDKGGNKKDPEKKKKKEKEKKM
IEEKGKDKKEEEKKEVVIIDPSGNAYYNWLFCITLPVMYNWTMIIARACFDELQSDYLGY
WLICDYTSDIAYLLDMFVRTRTGYLEQGLLVKDKYKLIEKYKSNLQFKLDFVSMIPTDVL
YFKLGWDYPEIRLNRLLRISRMFEFFQRTETRTNYPNIFRISNLVMYIVIIIHWNACVYY
SISKTVGFGNDTWVYPDVNDPEFGRLARKYVYSLYWSTLTLTTIGETPPPVLDSEYIFVV
IDFLIGVLIFATIVGNIGSMISNMNAARAEFQAKVDAIKQYMHFRNVSKDMEKRVIKWFD
YLWTNKKTVDEREVLRYLPDKLRAEIAINVHLDTLKKVRIFADCEAGLLVELVLKLQPQV
YSPGDYICKKGDIGREMYIIKEGKLAVVADDGITQFVVLSDGSYFGEISILNIKGSKAGN
RRTANIKSIGYSDLFCLSKDDLMEALTEYPDAKTMLEEKGRQILMKDGLLDLNIANAGSD
PKDLEEKVTQMEGSVDLLQIRFARILGEYESMQQKLKQRLTKVENFLKPLIDTEFSALEK
PGVESEPTESTQDWKPGY
Download sequence
Identical sequences G5B8D9
HGL_H00000384264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]