SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000384302 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000384302
Domain Number 1 Region: 19-307
Classification Level Classification E-value
Superfamily WD40 repeat-like 3e-36
Family WD40-repeat 0.0059
Further Details:      
 
Weak hits

Sequence:  HGL_H00000384302
Domain Number - Region: 502-564,611-649
Classification Level Classification E-value
Superfamily ARM repeat 0.00777
Family Armadillo repeat 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000384302
Sequence length 679
Comment WDR43 (Homo_sapiens) WD repeat domain 43
Sequence
MAAGGGGSCDPLAPAGVPCAFSPESQAYFALASTDGHLRVWETASNRLHQEYVPSAHLSG
TCTCLAWAPPRLQAKESHQRKKRKLEAIGTGDQIDLLALGTAVGSILLYSTVKGELHSKL
VGGGHDSRVNCIQWHQDSGCLYSCSDDKYIVEWNTWACKVKCKWKGDNSSVTSLCISPDG
KMLLSAGRTIKLWVLETKEVYRHFTGHATPVSSLMFTTIRPPNESQPFDGITGLYFLSGA
VHDRLLNVWQVRSENKEKNAVMSFTVTEEPVYIDLTLSENKEEPVKLAVVCRDGQVHLFE
HVLNGHCKKPLTSNCTIQIATPGKGKKSTPKPIPILAAGFCSDKMSLLLVYGNWFQPAME
QVALNSKEPHMCLVRDISNCWAPKVETAITKVRTPVMNSEAKVLVPGIPGHHAAIKPPLP
HTEEVESKRKLGGNEVSIEERLGAMDIDTKGGRDDLLQTNSFPVLLTQGLESNDFEMLNK
VLQTRNLNLIKKTVLRMPLHAVIPLLQELTKRLQGHPNSAVLMVQWLKCVLTVHASYLST
LPDLVHQLGTLYQLMESRVKTFQKLSHLHGKLILLITQVTASEKTKGMNSPGQKARLVYE
EESSEEESDDEIADKDSDDNWDEDEEEKESTKDEDTDEENEDDDEAEEKEENGGDRDIAI
EKELNGDSDLDPENESEEE
Download sequence
Identical sequences G5C2Y1
XP_004839294.1.39548 HGL_H00000384302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]