SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000384330 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000384330
Domain Number 1 Region: 59-840
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.76e-293
Family Motor proteins 7.44e-18
Further Details:      
 
Domain Number 2 Region: 841-965
Classification Level Classification E-value
Superfamily Myosin rod fragments 4.05e-28
Family Myosin rod fragments 0.0000013
Further Details:      
 
Domain Number 3 Region: 963-1074
Classification Level Classification E-value
Superfamily Myosin rod fragments 9.15e-24
Family Myosin rod fragments 0.0013
Further Details:      
 
Domain Number 4 Region: 1237-1344
Classification Level Classification E-value
Superfamily Myosin rod fragments 1.6e-20
Family Myosin rod fragments 0.0073
Further Details:      
 
Domain Number 5 Region: 1421-1543
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000000000000228
Family Myosin rod fragments 0.0064
Further Details:      
 
Weak hits

Sequence:  HGL_H00000384330
Domain Number - Region: 1701-1922
Classification Level Classification E-value
Superfamily Tropomyosin 0.00015
Family Tropomyosin 0.0017
Further Details:      
 
Domain Number - Region: 1071-1185
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000241
Family Myosin rod fragments 0.005
Further Details:      
 
Domain Number - Region: 1558-1650
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0262
Family Myosin rod fragments 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000384330
Sequence length 1925
Comment MYH8 (Homo_sapiens) myosin, heavy chain 8, skeletal muscle, perinatal
Sequence
MSSSSDAEMAIFGEAAPYLRKSERERIEAQNKPFDAKTSVFVAEPKESYVKSTIQSKEGG
KVTVKTEGGATLTVREDQVFPMNPPKYDKIEDMAMMTHLHEPGVLYNLKERYAAWMIYTY
SGLFCVTVNPYKWLPVYNPEVVGAYRGKKRQEAPPHIFSISDNAYQFMLTDRENQSILIT
GESGAGKTVNTKRVIQYFATIAVTGEKKKEESGKMQGTLEDQIISANPLLEAFGNAKTVR
NDNSSRFGKFIRIHFGTTGKLASADIETYLLEKSRVTFQLKAERSYHIFYQITSNKKPDL
IEMLLITTNPYDYAFVSQGEITVPSIDDQEELMATDSAIDILGFSPEEKVSIYKLTGAVM
HYGNMKFKQKQREEQAEPDGTEVADKAAYLQSLNSADLLKALCYPRVKVGNEYVTKGQTV
QQVYNAVGALAKAVYEKMFLWMVTRINQQLDTKQPRQYFIGVLDIAGFEIFDFNSLEQLC
INFTNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLAACIELIEKPLGIFSILEEE
CMFPKATDTSFKNKLYDQHLGKSANFQKPKPAKGKAEAHFSLVHYAGTVDYNIAGWLDKN
KDPLNDTVVGLYQKSAMKTLASLFSTYASAEGDSGAKKGAKKKGSSFQTVSALFRENLNK
LMTNLRSTHPHFVRCIIPNETKTPGAMEHELVLHQLRCNGVLEGIRICRKGFPSRILYGD
FKQRYKVLNASAIPEGQFIDSKKASEKLLASIDIDHTQYKFGHTKVFFKAGLLGLLEEMR
DEKLAQIITRTQAVCRGFLMRVEYQKMLQRREALFCIQYNVRAFMNVKHWPWMKLFFKIK
PLLKSAETEKEMATMKEEFQKTKDELAKSEAKRKELEEKMVTLLKEKNDLQLQVQSEADS
LADAEERCEQLIKNKIQLEAKIKEVTERAEDEEEINAELTAKKRKLEDECSELKKDIDDL
ELTLAKVEKEKHATENKVKNLTEEMAGLDETIAKLTKEKKALQEAHQQTLDDLQAEEDKV
NTLTKAKVKLEQQVDDLEGSLEQEKKLRMDLERAKRKLEGDLKLAQESTMDIENDKQQLD
EKLKKKEFEISNLISKIEDEQAVEIQLQKKIKELQARIEELEEEIEAERASRAKAEKQRS
DLSRELEEISERLEEAGGATSAQIEMNKKREAEFQKLRRDLEEATLQHEATAATLRKKHA
DSVAELGEQIDNLQRVKQKLEKEKSELKMEIDDLSSNAEAISKAKGNLEKMCRTLEDQVS
ELKTKEEEQQRLIHELTAQRARLQTEAGEYSRQLDEKDALVSQLSRGKQASTQQIEELKH
QLEEETKSRHDCDLLREQYEEEQEAKAELQRAMSANSSEVAQWRTKYETDAIQRTEELEE
AKKKLAQRLQEAEEHVEAVNAKCASLEKTKQRLQNEVEDLMLDVERSNAACAALDKKQRN
FDKILSEWKQKYEETQAELEASQKESRSLSTELFKVKNAYEESLDQLETLKRENKNLQQE
ISDLTEQIAEGGKQIHELEKIKKQVEQEKCDIQAALEEAEASLEHEEGKILRIQLELNQV
KSEVDRKIAEKDEEIDQLKRNHIRVVETLQSTLDAEIRRNDALRVKKKMEGDLNEMEIQL
NHANRLAAESLRNYRNTQGILKDTQLHLDDALRGQEDLKEQLAIVERRANLLQAEVEELR
AMLEQTERSRRIAEQELLDASERVQLLHTQNTSLINTKKKLENDVSQLQSEVEEVIQESR
NAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNLEQTVKDLQHRLDEAEQLALKGGK
KQIQKLEARVRELEGEVESEQKRNAEAVKGLRKHERRVKELTYQTEEDRKNVLRLQDLVD
KLQAKVKSYKRQAEEAEEQSNANLAKFRKLQHELEEAEERADIAESQVNKLRVKSREVHM
KINAE
Download sequence
Identical sequences G5B5I0
HGL_H00000384330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]