SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000384427 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000384427
Domain Number 1 Region: 312-400
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 4.45e-35
Family Small-conductance potassium channel 0.0000844
Further Details:      
 
Domain Number 2 Region: 214-357
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.62e-25
Family Voltage-gated potassium channels 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000384427
Sequence length 452
Comment KCNN4 (Homo_sapiens) potassium intermediate/small conductance calcium-activated channel, subfamily N, member 4
Sequence
MGGDLVAGLGALRRRKRLLEEEKWLAGWALALAGTGIGLMVLHAEMLWFGGCPATARELE
GTGGVKLSELQVPVYKLRWSLYLFLVKCTISLSTVLLLCFIVAFHAKEVQLFMTDNGLRD
WRVALTRRQVAQMVLELAVCGLHPAPVGAPPCVPGSEAQRAATQAWRSFLGEGEALLSLA
MLLRLYLVPRAVLLRSGVLLNASYRSIGALNQVRFRHWFVAKLYMNTHPGRLLLGLTLGL
WLTTAWVLSVAERQAVNATGHLSDTLWLIPITFLTIGYGDVVPGTVWGKIVCLCTGVMGV
CCTALLVAVVARKLEFNKAEKHVHNFMMDIHYTKEMKESAARLLQEAWMYYKHTRRKEPR
AARRHQRKLLAAIYTFRQVRLKHRKLREQVNSMVDISKMHMTLSDLKQRLSDSHEALEKQ
IDGLAGKLDTLSELISAALGPRQLPEPSQEAT
Download sequence
Identical sequences G5CBP3
HGL_H00000384427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]