SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000384491 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000384491
Domain Number 1 Region: 1-83
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.07e-30
Family Ras-binding domain, RBD 0.00000526
Further Details:      
 
Weak hits

Sequence:  HGL_H00000384491
Domain Number - Region: 147-347
Classification Level Classification E-value
Superfamily Tropomyosin 0.0085
Family Tropomyosin 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000384491
Sequence length 419
Comment RASSF8 (Homo_sapiens) Ras association (RalGDS/AF-6) domain family (N-terminal) member 8
Sequence
MELKVWVDGVQRIVCGVTEVTTCQEVVIALAQAIGRTGRYTLIEKWRDTERHLAPHENPI
ISLNKWGQYASDVQLILRRTGPSLSERPTSDSVARIPERTLYRQSLPPLAKLRPQVDKSI
KRREPKRKSLTFTGGAKGLIDIFGKGKETEFKQKMLNNCKTTADELKKLIHLQTEKLQSI
EKQLESNEIEIRFWEQKYNSNIEEEIVRLEQKIKRNDVEIEEEEFWENELQIEQENEKQL
KDQLQEIRQKITECESKLKDYLAQIQTMESSLEAEKLQREVQEAQVNEEEVKGKIRKVKG
EIDVQGQQSLRLENGIKAVERSLGQATKRLQDKEQELEQLTKELRQVNLQQFIQQTGTKV
TVLPADPIEIEASQADIEREAPFQSGSLKRPGSSRQLPSNLRILQNPISSGFNPEGIYV
Download sequence
Identical sequences G5BQA3
XP_004845798.1.39548 HGL_H00000384491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]